Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	414236
Gene name Gene Name - the full gene name approved by the HGNC.	Chromosome 10 putative open reading frame 55
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	C10orf55
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q22.2

Show/Hide all(93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT487061	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT487060	hsa-miR-1321	PAR-CLIP	23592263
MIRT487059	hsa-miR-4739	PAR-CLIP	23592263
MIRT487058	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT487057	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT487056	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT487054	hsa-miR-4419a	PAR-CLIP	23592263
MIRT487055	hsa-miR-4510	PAR-CLIP	23592263
MIRT487053	hsa-miR-6127	PAR-CLIP	23592263
MIRT487052	hsa-miR-6129	PAR-CLIP	23592263
MIRT487051	hsa-miR-6130	PAR-CLIP	23592263
MIRT487050	hsa-miR-6133	PAR-CLIP	23592263
MIRT487049	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT487048	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT487046	hsa-miR-3195	PAR-CLIP	23592263
MIRT487047	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT487045	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT487044	hsa-miR-4467	PAR-CLIP	23592263
MIRT487043	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT487042	hsa-miR-8085	PAR-CLIP	23592263
MIRT487041	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487040	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487039	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487038	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487037	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT487036	hsa-miR-3180	PAR-CLIP	23592263
MIRT487035	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT487034	hsa-miR-3196	PAR-CLIP	23592263
MIRT487033	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT487061	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT487060	hsa-miR-1321	PAR-CLIP	23592263
MIRT487059	hsa-miR-4739	PAR-CLIP	23592263
MIRT487058	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT487057	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT487056	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT487054	hsa-miR-4419a	PAR-CLIP	23592263
MIRT487055	hsa-miR-4510	PAR-CLIP	23592263
MIRT487053	hsa-miR-6127	PAR-CLIP	23592263
MIRT487052	hsa-miR-6129	PAR-CLIP	23592263
MIRT487051	hsa-miR-6130	PAR-CLIP	23592263
MIRT487050	hsa-miR-6133	PAR-CLIP	23592263
MIRT487049	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT487048	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT487046	hsa-miR-3195	PAR-CLIP	23592263
MIRT487047	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT487045	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT487044	hsa-miR-4467	PAR-CLIP	23592263
MIRT487043	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT487042	hsa-miR-8085	PAR-CLIP	23592263
MIRT487041	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487040	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487039	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487038	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487037	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT487036	hsa-miR-3180	PAR-CLIP	23592263
MIRT487035	hsa-miR-3180-3p	PAR-CLIP	23592263
MIRT487034	hsa-miR-3196	PAR-CLIP	23592263
MIRT487033	hsa-miR-6816-5p	PAR-CLIP	23592263
MIRT828939	hsa-miR-1207-3p	CLIP-seq
MIRT828940	hsa-miR-1270	CLIP-seq
MIRT828941	hsa-miR-27a	CLIP-seq
MIRT828942	hsa-miR-27b	CLIP-seq
MIRT828943	hsa-miR-3135b	CLIP-seq
MIRT828944	hsa-miR-361-3p	CLIP-seq
MIRT828945	hsa-miR-3679-3p	CLIP-seq
MIRT828946	hsa-miR-4683	CLIP-seq
MIRT828947	hsa-miR-513a-5p	CLIP-seq
MIRT828948	hsa-miR-620	CLIP-seq
MIRT1945410	hsa-miR-3200-5p	CLIP-seq
MIRT1945411	hsa-miR-4427	CLIP-seq
MIRT1945412	hsa-miR-4680-3p	CLIP-seq
MIRT2183799	hsa-miR-4707-5p	CLIP-seq
MIRT2435831	hsa-miR-378g	CLIP-seq
MIRT2435832	hsa-miR-4292	CLIP-seq
MIRT2435833	hsa-miR-4308	CLIP-seq
MIRT2435834	hsa-miR-4437	CLIP-seq
MIRT2435835	hsa-miR-4674	CLIP-seq
MIRT2183799	hsa-miR-4707-5p	CLIP-seq
MIRT2435831	hsa-miR-378g	CLIP-seq
MIRT2435832	hsa-miR-4292	CLIP-seq
MIRT2435833	hsa-miR-4308	CLIP-seq
MIRT2435834	hsa-miR-4437	CLIP-seq
MIRT2435835	hsa-miR-4674	CLIP-seq
MIRT2183799	hsa-miR-4707-5p	CLIP-seq
MIRT828939	hsa-miR-1207-3p	CLIP-seq
MIRT828941	hsa-miR-27a	CLIP-seq
MIRT828942	hsa-miR-27b	CLIP-seq
MIRT828947	hsa-miR-513a-5p	CLIP-seq
MIRT828939	hsa-miR-1207-3p	CLIP-seq
MIRT828941	hsa-miR-27a	CLIP-seq
MIRT828942	hsa-miR-27b	CLIP-seq
MIRT2676289	hsa-miR-4734	CLIP-seq
MIRT828947	hsa-miR-513a-5p	CLIP-seq

Show/Hide all(2)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0042802	Function	Identical protein binding	IPI	32296183

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q5SWW7

Protein name

Uncharacterized protein C10orf55

Family and domains

Sequence

MFLHLDSHSSLERTKPTVVGVDTHMELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPI
PKPTLPSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPT
PVVLKPPLPPCPISWGESGPAVDGIRRTPAP

Sequence length

151

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	23128233

Show/Hide Unknown Diseases (7)

Disease term	Disease name	References	Source
Unknown
Crohn disease	Crohn Disease	28067908	ClinVar
Inflammatory Bowel Disease	Inflammatory Bowel Disease		GWAS
Multiple Sclerosis	Multiple Sclerosis		GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus		GWAS
Crohn Disease	Crohn Disease		GWAS
Psoriasis vulgaris	Psoriasis vulgaris		GWAS
Psoriasis	Psoriasis		GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinoma Squamous Cell	Associate	36845013
Hemostatic Disorders	Associate	29334895
Venous Thrombosis	Associate	29334895

C10orf55 (chromosome 10 putative open reading frame 55)