C10orf55 (chromosome 10 putative open reading frame 55)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 414236
Gene name Chromosome 10 putative open reading frame 55
Gene symbol C10orf55
Synonyms (NCBI Gene)
-
Chromosome 10
Chromosome location 10q22.2
miRNA miRNA information provided by mirtarbase database.
93
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (93)
miRTarBase ID miRNA Experiments Reference
MIRT487061 hsa-miR-6873-5p PAR-CLIP 23592263
MIRT487060 hsa-miR-1321 PAR-CLIP 23592263
MIRT487059 hsa-miR-4739 PAR-CLIP 23592263
MIRT487058 hsa-miR-4756-5p PAR-CLIP 23592263
MIRT487057 hsa-miR-6784-5p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (2)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 32296183, 33961781
GO:0042802 Function Identical protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5SWW7
Protein name Uncharacterized protein C10orf55
Family and domains
Sequence 
MFLHLDSHSSLERTKPTVVGVDTHMELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPI
PKPTLPSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPT
PVVLKPPLPPCPISWGESGPAVDGIRRTPAP
Sequence length 151
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
C10orf55-related disorder Likely benign rs774129403, rs371765951 RCV003982112
RCV003981334
Show/Hide Text Mining Associations (3)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Squamous Cell Associate 36845013
Hemostatic Disorders Associate 29334895
Venous Thrombosis Associate 29334895