C10orf55 (chromosome 10 putative open reading frame 55)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
414236
Gene name Gene Name - the full gene name approved by the HGNC.
Chromosome 10 putative open reading frame 55
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
C10orf55
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q22.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(93)
miRTarBase ID miRNA Experiments Reference
MIRT487061 hsa-miR-6873-5p PAR-CLIP 23592263
MIRT487060 hsa-miR-1321 PAR-CLIP 23592263
MIRT487059 hsa-miR-4739 PAR-CLIP 23592263
MIRT487058 hsa-miR-4756-5p PAR-CLIP 23592263
MIRT487057 hsa-miR-6784-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 32296183, 33961781
GO:0042802 Function Identical protein binding IPI 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q5SWW7
Protein name Uncharacterized protein C10orf55
Family and domains
Sequence 
MFLHLDSHSSLERTKPTVVGVDTHMELDEVHCCPGRDSGGGFIKGPMLQGLQGEGKLAPI
PKPTLPSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAGWGSPGGLFLPCQPVPT
PVVLKPPLPPCPISWGESGPAVDGIRRTPAP
Sequence length 151
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (6)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Squamous Cell Associate 36845013
Hemostatic Disorders Associate 29334895
Venous Thrombosis Associate 29334895