Gene Gene information from NCBI Gene database.
Entrez ID 4140
Gene name Microtubule affinity regulating kinase 3
Gene symbol MARK3
Synonyms (NCBI Gene)
CTAK1KP78PAR1APar-1aVIPB
Chromosome 14
Chromosome location 14q32.32-q32.33
Summary The protein encoded by this gene is activated by phosphorylation and in turn is involved in the phosphorylation of tau proteins MAP2 and MAP4. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs376395495 C>G,T Pathogenic Coding sequence variant, intron variant, missense variant
miRNA miRNA information provided by mirtarbase database.
119
miRTarBase ID miRNA Experiments Reference
MIRT043531 hsa-miR-331-3p CLASH 23622248
MIRT1132648 hsa-miR-1228 CLIP-seq
MIRT1132649 hsa-miR-1270 CLIP-seq
MIRT1132650 hsa-miR-1912 CLIP-seq
MIRT1132651 hsa-miR-302f CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000226 Process Microtubule cytoskeleton organization IBA
GO:0004672 Function Protein kinase activity IEA
GO:0004674 Function Protein serine/threonine kinase activity EXP 16822840
GO:0004674 Function Protein serine/threonine kinase activity IDA 9543386, 12941695, 16822840, 16980613
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602678 6897 ENSG00000075413
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P27448
Protein name MAP/microtubule affinity-regulating kinase 3 (EC 2.7.11.1) (C-TAK1) (cTAK1) (Cdc25C-associated protein kinase 1) (ELKL motif kinase 2) (EMK-2) (Protein kinase STK10) (Ser/Thr protein kinase PAR-1) (Par-1a) (Serine/threonine-protein kinase p78)
Protein function Serine/threonine-protein kinase (PubMed:16822840, PubMed:16980613, PubMed:23666762). Involved in the specific phosphorylation of microtubule-associated proteins for MAP2 and MAP4. Phosphorylates the microtubule-associated protein MAPT/TAU (PubMe
PDB 2QNJ , 3FE3 , 7P1L , 8UOH , 8UOI , 8UOJ , 8UOK , 8UOL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 56 307 Protein kinase domain Domain
PF00627 UBA 327 363 UBA/TS-N domain Domain
PF02149 KA1 709 753 Kinase associated domain 1 Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLK
TIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFE
VIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLK
AENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLG
VILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQ
IMKDRWI
NAGHEEDELKPFVEPELDISDQKRIDIMVGMGYSQEEIQESLSKMKYDEITAT
YLL
LGRKSSELDASDSSSSSNLSLAKVRPSSDLNNSTGQSPHHKVQRSVSSSQKQRRYSD
HAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNK
ADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVAS
THSISSAATPDRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRG
STNLFSKLTSKLTRRNMSFRFIKRLPTEYERNGRYEGSSRNVSAEQKDENKEAKPRSLRF
TWSMKTTSSMDPGDMMREIRKVLDANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKL
PRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Sequence length 753
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RAF activation
MAP2K and MAPK activation
Negative regulation of MAPK pathway
Signaling by moderate kinase activity BRAF mutants
Signaling by high-kinase activity BRAF mutants
Signaling by BRAF and RAF fusions
Paradoxical activation of RAF signaling by kinase inactive BRAF
Signaling downstream of RAS mutants
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
25
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Visual impairment and progressive phthisis bulbi Pathogenic rs376395495 RCV000736034
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Uncertain significance rs749743518 RCV005929215
Cervical cancer Benign rs56305318 RCV005935336
Colon adenocarcinoma Benign rs56305318 RCV005935332
Hepatocellular carcinoma Benign rs2273699, rs56305318 RCV005922424
RCV005935333
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 21811019, 24533944
Carcinoma Non Small Cell Lung Associate 36922348
Headache Associate 38087366
Myopathy Granulovacuolar Lobular with Electrical Myotonia Associate 24533944
Neoplasms Inhibit 35017636
Obesity Associate 29145611
Osteoporosis Associate 29145611
Ovarian Neoplasms Inhibit 35017636
Spinal Muscular Atrophies of Childhood Associate 20697106
Uveal melanoma Associate 37923138