Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	4139
Gene name	Microtubule affinity regulating kinase 1
Gene symbol	MARK1
Synonyms (NCBI Gene)	MARKPar-1cPar1c
Chromosome	1
Chromosome location	1q41

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT656421	hsa-miR-1283	HITS-CLIP	23824327
MIRT656420	hsa-miR-3616-5p	HITS-CLIP	23824327
MIRT656419	hsa-miR-573	HITS-CLIP	23824327
MIRT656421	hsa-miR-1283	HITS-CLIP	23824327
MIRT656420	hsa-miR-3616-5p	HITS-CLIP	23824327
MIRT656419	hsa-miR-573	HITS-CLIP	23824327
MIRT737308	hsa-miR-486-5p	Luciferase reporter assayWestern blottingqRT-PCR	32547110
MIRT656421	hsa-miR-1283	HITS-CLIP	23824327
MIRT656420	hsa-miR-3616-5p	HITS-CLIP	23824327
MIRT656419	hsa-miR-573	HITS-CLIP	23824327
MIRT656421	hsa-miR-1283	HITS-CLIP	23824327
MIRT656420	hsa-miR-3616-5p	HITS-CLIP	23824327
MIRT656419	hsa-miR-573	HITS-CLIP	23824327
MIRT1132532	hsa-miR-101	CLIP-seq
MIRT1132533	hsa-miR-128	CLIP-seq
MIRT1132534	hsa-miR-144	CLIP-seq
MIRT1132535	hsa-miR-221	CLIP-seq
MIRT1132536	hsa-miR-222	CLIP-seq
MIRT1132537	hsa-miR-27a	CLIP-seq
MIRT1132538	hsa-miR-27b	CLIP-seq
MIRT1132539	hsa-miR-300	CLIP-seq
MIRT1132540	hsa-miR-381	CLIP-seq
MIRT1132541	hsa-miR-3922-5p	CLIP-seq
MIRT1132542	hsa-miR-3973	CLIP-seq
MIRT1132543	hsa-miR-4307	CLIP-seq
MIRT1132544	hsa-miR-4503	CLIP-seq
MIRT1132545	hsa-miR-4666-3p	CLIP-seq
MIRT1132546	hsa-miR-4680-3p	CLIP-seq
MIRT1132547	hsa-miR-4724-5p	CLIP-seq
MIRT1132548	hsa-miR-4781-3p	CLIP-seq
MIRT1132549	hsa-miR-499-3p	CLIP-seq
MIRT1132550	hsa-miR-499a-3p	CLIP-seq
MIRT1132551	hsa-miR-513a-3p	CLIP-seq
MIRT1132552	hsa-miR-520g	CLIP-seq
MIRT1132553	hsa-miR-520h	CLIP-seq
MIRT1132554	hsa-miR-567	CLIP-seq
MIRT1132555	hsa-miR-570	CLIP-seq
MIRT1132556	hsa-miR-582-5p	CLIP-seq
MIRT2037758	hsa-miR-1305	CLIP-seq
MIRT2037759	hsa-miR-3671	CLIP-seq
MIRT2037760	hsa-miR-4795-3p	CLIP-seq
MIRT2267825	hsa-miR-3924	CLIP-seq
MIRT2267826	hsa-miR-542-3p	CLIP-seq
MIRT1132532	hsa-miR-101	CLIP-seq
MIRT1132534	hsa-miR-144	CLIP-seq
MIRT2431020	hsa-miR-299-5p	CLIP-seq
MIRT1132551	hsa-miR-513a-3p	CLIP-seq

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	ISS	9108484
GO:0000287	Function	Magnesium ion binding	IDA	14976552
GO:0001764	Process	Neuron migration	ISS
GO:0001786	Function	Phosphatidylserine binding	IDA	21145462
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	14976552
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	10542369, 28386764
GO:0005515	Function	Protein binding	IPI	23666762, 32296183, 32814053
GO:0005524	Function	ATP binding	IDA	14976552
GO:0005524	Function	ATP binding	IEA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IDA	21145462
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23666762
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	ISS
GO:0005886	Component	Plasma membrane	IDA	21145462
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	14976552
GO:0006468	Process	Protein phosphorylation	IMP	23666762
GO:0007010	Process	Cytoskeleton organization	ISS
GO:0008289	Function	Lipid binding	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	31281935
GO:0010629	Process	Negative regulation of gene expression	IDA	31281935
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	31281935
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010975	Process	Regulation of neuron projection development	ISS
GO:0015630	Component	Microtubule cytoskeleton	TAS	9108484
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030425	Component	Dendrite	IDA	23666762
GO:0030425	Component	Dendrite	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	14976552
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050321	Function	Tau-protein kinase activity	IMP	23666762
GO:0050321	Function	Tau-protein kinase activity	ISS
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050773	Process	Regulation of dendrite development	IEA
GO:0050773	Process	Regulation of dendrite development	ISS
GO:0051654	Process	Establishment of mitochondrion localization	IEA
GO:0051654	Process	Establishment of mitochondrion localization	ISS
GO:0070300	Function	Phosphatidic acid binding	IDA	21145462
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA

MIM	HGNC	e!Ensembl
606511	6896	ENSG00000116141

Q9P0L2

Protein name

Serine/threonine-protein kinase MARK1 (EC 2.7.11.1) (EC 2.7.11.26) (MAP/microtubule affinity-regulating kinase 1) (PAR1 homolog c) (Par-1c) (Par1c)

Protein function

Serine/threonine-protein kinase (PubMed:23666762). Involved in cell polarity and microtubule dynamics regulation. Phosphorylates DCX, MAP2 and MAP4. Phosphorylates the microtubule-associated protein MAPT/TAU (PubMed:23666762). Involved in cell p

PDB

2HAK , 3OSE , 6C9D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	60 → 311	Protein kinase domain	Domain
PF00627	UBA	331 → 367	UBA/TS-N domain	Domain
PF02149	KA1	751 → 795	Kinase associated domain 1	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, skeletal muscle, brain, fetal brain and fetal kidney. {ECO:0000269|PubMed:9108484}.

Sequence

MSARTPLPTVNERDTENHTSVDGYTEPHIQPTKSSSRQNIPRCRNSITSATDEQPHIGNY
RLQKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIV
KLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKYIVH
RDLKAENLLLDGDMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDV
WSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRG
SLEQIMKDRWMNVGHEEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDE
VMATYILLGRKPPEFEGGESLSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQR
RFSDHAGPSIPPAVSYTKRPQANSVESEQKEEWDKDVARKLGSTTVGSKSEMTASPLVGP
ERKKSSTIPSNNVYSGGSMARRNTYVCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSV
ASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPD
RTRFPRGSSSRSTFHGEQLRERRSVAYNGPPASPSHETGAFAHARRGTSTGIISKITSKF
VRRDPSEGEASGRTDTSRSTSGEPKERDKEEGKDSKPRSLRFTWSMKTTSSMDPNDMMRE
IRKVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSI
AFKNIASKIANELKL

Sequence length

795

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	rs1359424178	RCV004557789

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	21811019, 27879374, 30099988
Autistic Disorder	Associate	27879374
Colorectal Neoplasms	Associate	31281935
Endometrial Neoplasms	Associate	36352482
Epstein Barr Virus Infections	Associate	23829175
Glucose Intolerance	Associate	33967958
Hyperglycemia	Associate	33967958
Hyperinsulinism	Associate	33967958
Nasopharyngeal Carcinoma	Associate	34261404
Neoplasms	Associate	27879374, 30099988, 36352482
Stomach Neoplasms	Associate	16367923, 23829175
Uterine Cervical Neoplasms	Associate	36352482

MARK1 (microtubule affinity regulating kinase 1)