Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4137
Gene name Gene Name - the full gene name approved by the HGNC.	Microtubule associated protein tau
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAPT
Synonyms (NCBI Gene) Gene synonyms aliases	DDPAC, FTD1, FTDP-17, MAPTL, MSTD, MTBT1, MTBT2, PPND, PPP1R103, TAU, Tau-PHF6, tau-40
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stag

Show/Hide all(35)

SNP ID	Visualize variation	Clinical significance	Consequence
rs63750013	G>A,C	Pathogenic	Intron variant
rs63750092	A>T	Pathogenic, not-provided	Non coding transcript variant, missense variant, coding sequence variant
rs63750129	A>C	Pathogenic, not-provided	Non coding transcript variant, missense variant, coding sequence variant
rs63750162	C>G	Likely-pathogenic	Intron variant
rs63750308	A>G	Pathogenic, not-provided	Intron variant
rs63750349	C>G,T	Pathogenic, not-provided	Synonymous variant, non coding transcript variant, missense variant, coding sequence variant
rs63750376	G>T	Pathogenic, not-provided	Non coding transcript variant, missense variant, coding sequence variant
rs63750424	C>T	Pathogenic	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750425	C>T	Pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750512	G>A,C	Likely-pathogenic, pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750568	T>C	Pathogenic, not-provided	Synonymous variant, intron variant, coding sequence variant
rs63750570	G>A	Pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750635	C>T	Pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750688	AAG>-	Conflicting-interpretations-of-pathogenicity, not-provided	Inframe deletion, intron variant, coding sequence variant
rs63750711	A>T	Pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750756	T>G	Pathogenic, not-provided	Intron variant, missense variant, coding sequence variant
rs63750869	G>A	Likely-pathogenic, uncertain-significance	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63750912	T>C	Pathogenic, not-provided	Synonymous variant, intron variant, coding sequence variant
rs63750959	G>A,T	Likely-benign, pathogenic, not-provided	Non coding transcript variant, missense variant, coding sequence variant
rs63750972	C>T	Pathogenic, not-provided	Intron variant
rs63751011	C>T	Pathogenic	Intron variant
rs63751165	G>A,T	Pathogenic, not-provided	Intron variant, missense variant, coding sequence variant
rs63751264	A>T	Pathogenic, not-provided	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs63751273	C>T	Pathogenic	Intron variant, missense variant, coding sequence variant
rs63751391	G>T	Pathogenic, not-provided	Intron variant, missense variant, coding sequence variant
rs63751392	ATA>-	Risk-factor, pathogenic, not-provided	Inframe deletion, intron variant, coding sequence variant
rs63751394	T>C	Pathogenic, not-provided	Intron variant
rs63751438	C>T	Pathogenic, not-provided	Intron variant, missense variant, coding sequence variant
rs63751443	G>A	Conflicting-interpretations-of-pathogenicity	Intron variant
rs143956882	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, intron variant, missense variant
rs1568327531	G>A	Pathogenic	Intron variant, splice donor variant
rs1568339821	A>G	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant, intron variant
rs1568339995	C>T	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant, intron variant
rs1598408073	G>C	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, non coding transcript variant, intron variant
rs1598408336	C>A	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant, intron variant

Show/Hide all(386)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007189	hsa-miR-34c-5p	Luciferase reporter assay	23423488
MIRT007189	hsa-miR-34c-5p	Luciferase reporter assay	23423488
MIRT723044	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT723043	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT723042	hsa-miR-548q	HITS-CLIP	19536157
MIRT723041	hsa-miR-938	HITS-CLIP	19536157
MIRT723040	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT723039	hsa-miR-4312	HITS-CLIP	19536157
MIRT723038	hsa-miR-3157-3p	HITS-CLIP	19536157
MIRT723037	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT723036	hsa-miR-6741-5p	HITS-CLIP	19536157
MIRT443435	hsa-miR-4796-3p	PAR-CLIP	22100165
MIRT443434	hsa-miR-3677-5p	PAR-CLIP	22100165
MIRT443432	hsa-miR-8063	PAR-CLIP	22100165
MIRT443433	hsa-miR-520g-3p	PAR-CLIP	22100165
MIRT443431	hsa-miR-520h	PAR-CLIP	22100165
MIRT443430	hsa-miR-4772-3p	PAR-CLIP	22100165
MIRT443429	hsa-miR-2276-3p	PAR-CLIP	22100165
MIRT443428	hsa-miR-3926	PAR-CLIP	22100165
MIRT443427	hsa-miR-4527	PAR-CLIP	22100165
MIRT443426	hsa-miR-6503-5p	PAR-CLIP	22100165
MIRT443425	hsa-miR-518a-5p	PAR-CLIP	22100165
MIRT443424	hsa-miR-527	PAR-CLIP	22100165
MIRT443423	hsa-miR-548s	PAR-CLIP	22100165
MIRT732538	hsa-miR-362-3p	Microarray, qRT-PCR, Western blotting	31496800
MIRT732539	hsa-miR-766-3p	Microarray, qRT-PCR, Western blotting	31496800
MIRT732539	hsa-miR-766-3p	Microarray, qRT-PCR, Western blotting	31496800
MIRT732541	hsa-miR-6507-3p	Microarray, qRT-PCR, Western blotting	31496800
MIRT732670	hsa-miR-181c-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blotting	32891070
MIRT734258	hsa-miR-483-5p	Western blotting, qRT-PCR	33915734
MIRT723044	hsa-miR-4793-5p	HITS-CLIP	19536157
MIRT723043	hsa-miR-1915-5p	HITS-CLIP	19536157
MIRT723042	hsa-miR-548q	HITS-CLIP	19536157
MIRT723041	hsa-miR-938	HITS-CLIP	19536157
MIRT723040	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT723039	hsa-miR-4312	HITS-CLIP	19536157
MIRT723038	hsa-miR-3157-3p	HITS-CLIP	19536157
MIRT723037	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT723036	hsa-miR-6741-5p	HITS-CLIP	19536157
MIRT443435	hsa-miR-4796-3p	PAR-CLIP	22100165
MIRT443434	hsa-miR-3677-5p	PAR-CLIP	22100165
MIRT443432	hsa-miR-8063	PAR-CLIP	22100165
MIRT443433	hsa-miR-520g-3p	PAR-CLIP	22100165
MIRT443431	hsa-miR-520h	PAR-CLIP	22100165
MIRT443430	hsa-miR-4772-3p	PAR-CLIP	22100165
MIRT443429	hsa-miR-2276-3p	PAR-CLIP	22100165
MIRT443428	hsa-miR-3926	PAR-CLIP	22100165
MIRT443427	hsa-miR-4527	PAR-CLIP	22100165
MIRT443426	hsa-miR-6503-5p	PAR-CLIP	22100165
MIRT443425	hsa-miR-518a-5p	PAR-CLIP	22100165
MIRT443424	hsa-miR-527	PAR-CLIP	22100165
MIRT443423	hsa-miR-548s	PAR-CLIP	22100165
MIRT1131814	hsa-miR-1207-5p	CLIP-seq
MIRT1131815	hsa-miR-181a	CLIP-seq
MIRT1131816	hsa-miR-181b	CLIP-seq
MIRT1131817	hsa-miR-181c	CLIP-seq
MIRT1131818	hsa-miR-181d	CLIP-seq
MIRT1131819	hsa-miR-3150a-3p	CLIP-seq
MIRT1131820	hsa-miR-3175	CLIP-seq
MIRT1131821	hsa-miR-3616-3p	CLIP-seq
MIRT1131822	hsa-miR-3924	CLIP-seq
MIRT1131823	hsa-miR-421	CLIP-seq
MIRT1131824	hsa-miR-4262	CLIP-seq
MIRT1131825	hsa-miR-4436b-3p	CLIP-seq
MIRT1131826	hsa-miR-4704-5p	CLIP-seq
MIRT1131827	hsa-miR-4709-5p	CLIP-seq
MIRT1131828	hsa-miR-4728-5p	CLIP-seq
MIRT1131829	hsa-miR-4763-3p	CLIP-seq
MIRT1131830	hsa-miR-939	CLIP-seq
MIRT1131831	hsa-miR-1202	CLIP-seq
MIRT1131832	hsa-miR-1207-3p	CLIP-seq
MIRT1131814	hsa-miR-1207-5p	CLIP-seq
MIRT1131833	hsa-miR-1229	CLIP-seq
MIRT1131834	hsa-miR-1266	CLIP-seq
MIRT1131835	hsa-miR-1286	CLIP-seq
MIRT1131836	hsa-miR-1291	CLIP-seq
MIRT1131837	hsa-miR-132	CLIP-seq
MIRT1131838	hsa-miR-1324	CLIP-seq
MIRT1131839	hsa-miR-1470	CLIP-seq
MIRT1131840	hsa-miR-151-5p	CLIP-seq
MIRT1131841	hsa-miR-151b	CLIP-seq
MIRT1131842	hsa-miR-1587	CLIP-seq
MIRT1131815	hsa-miR-181a	CLIP-seq
MIRT1131816	hsa-miR-181b	CLIP-seq
MIRT1131817	hsa-miR-181c	CLIP-seq
MIRT1131818	hsa-miR-181d	CLIP-seq
MIRT1131843	hsa-miR-1915	CLIP-seq
MIRT1131844	hsa-miR-197	CLIP-seq
MIRT1131845	hsa-miR-2053	CLIP-seq
MIRT1131846	hsa-miR-212	CLIP-seq
MIRT1131847	hsa-miR-2467-3p	CLIP-seq
MIRT1131848	hsa-miR-2682	CLIP-seq
MIRT1131849	hsa-miR-27a	CLIP-seq
MIRT1131850	hsa-miR-27b	CLIP-seq
MIRT1131819	hsa-miR-3150a-3p	CLIP-seq
MIRT1131851	hsa-miR-3153	CLIP-seq
MIRT1131852	hsa-miR-3166	CLIP-seq
MIRT1131820	hsa-miR-3175	CLIP-seq
MIRT1131853	hsa-miR-3184	CLIP-seq
MIRT1131854	hsa-miR-3194-5p	CLIP-seq
MIRT1131855	hsa-miR-34a	CLIP-seq
MIRT1131821	hsa-miR-3616-3p	CLIP-seq
MIRT1131856	hsa-miR-3664-3p	CLIP-seq
MIRT1131857	hsa-miR-371b-3p	CLIP-seq
MIRT1131858	hsa-miR-3972	CLIP-seq
MIRT1131823	hsa-miR-421	CLIP-seq
MIRT1131859	hsa-miR-423-5p	CLIP-seq
MIRT1131824	hsa-miR-4262	CLIP-seq
MIRT1131860	hsa-miR-4299	CLIP-seq
MIRT1131861	hsa-miR-4302	CLIP-seq
MIRT1131862	hsa-miR-4307	CLIP-seq
MIRT1131863	hsa-miR-4308	CLIP-seq
MIRT1131864	hsa-miR-4323	CLIP-seq
MIRT1131865	hsa-miR-4426	CLIP-seq
MIRT1131866	hsa-miR-4433	CLIP-seq
MIRT1131825	hsa-miR-4436b-3p	CLIP-seq
MIRT1131867	hsa-miR-4437	CLIP-seq
MIRT1131868	hsa-miR-4456	CLIP-seq
MIRT1131869	hsa-miR-4488	CLIP-seq
MIRT1131870	hsa-miR-449a	CLIP-seq
MIRT1131871	hsa-miR-449b	CLIP-seq
MIRT1131872	hsa-miR-449c	CLIP-seq
MIRT1131873	hsa-miR-4518	CLIP-seq
MIRT1131874	hsa-miR-4534	CLIP-seq
MIRT1131875	hsa-miR-4639-3p	CLIP-seq
MIRT1131876	hsa-miR-4647	CLIP-seq
MIRT1131877	hsa-miR-4653-3p	CLIP-seq
MIRT1131878	hsa-miR-4662b	CLIP-seq
MIRT1131879	hsa-miR-4667-3p	CLIP-seq
MIRT1131880	hsa-miR-4674	CLIP-seq
MIRT1131881	hsa-miR-4697-3p	CLIP-seq
MIRT1131882	hsa-miR-4697-5p	CLIP-seq
MIRT1131826	hsa-miR-4704-5p	CLIP-seq
MIRT1131827	hsa-miR-4709-5p	CLIP-seq
MIRT1131883	hsa-miR-4722-5p	CLIP-seq
MIRT1131828	hsa-miR-4728-5p	CLIP-seq
MIRT1131884	hsa-miR-4731-5p	CLIP-seq
MIRT1131885	hsa-miR-4737	CLIP-seq
MIRT1131829	hsa-miR-4763-3p	CLIP-seq
MIRT1131886	hsa-miR-486-3p	CLIP-seq
MIRT1131887	hsa-miR-487a	CLIP-seq
MIRT1131888	hsa-miR-509-3p	CLIP-seq
MIRT1131889	hsa-miR-5096	CLIP-seq
MIRT1131890	hsa-miR-513a-5p	CLIP-seq
MIRT1131891	hsa-miR-579	CLIP-seq
MIRT1131892	hsa-miR-637	CLIP-seq
MIRT1131893	hsa-miR-646	CLIP-seq
MIRT1131894	hsa-miR-668	CLIP-seq
MIRT1131895	hsa-miR-765	CLIP-seq
MIRT1131896	hsa-miR-885-3p	CLIP-seq
MIRT1131897	hsa-miR-922	CLIP-seq
MIRT1131830	hsa-miR-939	CLIP-seq
MIRT1131898	hsa-miR-940	CLIP-seq
MIRT1131899	hsa-miR-106a	CLIP-seq
MIRT1131900	hsa-miR-106b	CLIP-seq
MIRT1131814	hsa-miR-1207-5p	CLIP-seq
MIRT1131901	hsa-miR-1252	CLIP-seq
MIRT1131834	hsa-miR-1266	CLIP-seq
MIRT1131837	hsa-miR-132	CLIP-seq
MIRT1131902	hsa-miR-142-5p	CLIP-seq
MIRT1131903	hsa-miR-17	CLIP-seq
MIRT1131904	hsa-miR-1976	CLIP-seq
MIRT1131905	hsa-miR-204	CLIP-seq
MIRT1131906	hsa-miR-20a	CLIP-seq
MIRT1131907	hsa-miR-20b	CLIP-seq
MIRT1131908	hsa-miR-211	CLIP-seq
MIRT1131846	hsa-miR-212	CLIP-seq
MIRT1131909	hsa-miR-214	CLIP-seq
MIRT1131910	hsa-miR-3120-3p	CLIP-seq
MIRT1131819	hsa-miR-3150a-3p	CLIP-seq
MIRT1131851	hsa-miR-3153	CLIP-seq
MIRT1131911	hsa-miR-3161	CLIP-seq
MIRT1131912	hsa-miR-3174	CLIP-seq
MIRT1131820	hsa-miR-3175	CLIP-seq
MIRT1131853	hsa-miR-3184	CLIP-seq
MIRT1131913	hsa-miR-3185	CLIP-seq
MIRT1131855	hsa-miR-34a	CLIP-seq
MIRT1131914	hsa-miR-3609	CLIP-seq
MIRT1131821	hsa-miR-3616-3p	CLIP-seq
MIRT1131915	hsa-miR-3619-5p	CLIP-seq
MIRT1131916	hsa-miR-3620	CLIP-seq
MIRT1131856	hsa-miR-3664-3p	CLIP-seq
MIRT1131917	hsa-miR-3675-3p	CLIP-seq
MIRT1131918	hsa-miR-3692	CLIP-seq
MIRT1131919	hsa-miR-3945	CLIP-seq
MIRT1131859	hsa-miR-423-5p	CLIP-seq
MIRT1131920	hsa-miR-4291	CLIP-seq
MIRT1131861	hsa-miR-4302	CLIP-seq
MIRT1131865	hsa-miR-4426	CLIP-seq
MIRT1131825	hsa-miR-4436b-3p	CLIP-seq
MIRT1131870	hsa-miR-449a	CLIP-seq
MIRT1131871	hsa-miR-449b	CLIP-seq
MIRT1131873	hsa-miR-4518	CLIP-seq
MIRT1131874	hsa-miR-4534	CLIP-seq
MIRT1131921	hsa-miR-4635	CLIP-seq
MIRT1131875	hsa-miR-4639-3p	CLIP-seq
MIRT1131876	hsa-miR-4647	CLIP-seq
MIRT1131877	hsa-miR-4653-3p	CLIP-seq
MIRT1131878	hsa-miR-4662b	CLIP-seq
MIRT1131922	hsa-miR-4694-3p	CLIP-seq
MIRT1131881	hsa-miR-4697-3p	CLIP-seq
MIRT1131827	hsa-miR-4709-5p	CLIP-seq
MIRT1131828	hsa-miR-4728-5p	CLIP-seq
MIRT1131923	hsa-miR-4738-3p	CLIP-seq
MIRT1131924	hsa-miR-4755-5p	CLIP-seq
MIRT1131829	hsa-miR-4763-3p	CLIP-seq
MIRT1131925	hsa-miR-4775	CLIP-seq
MIRT1131926	hsa-miR-4797-3p	CLIP-seq
MIRT1131927	hsa-miR-4802-5p	CLIP-seq
MIRT1131889	hsa-miR-5096	CLIP-seq
MIRT1131928	hsa-miR-519d	CLIP-seq
MIRT1131929	hsa-miR-548ah	CLIP-seq
MIRT1131930	hsa-miR-548g	CLIP-seq
MIRT1131891	hsa-miR-579	CLIP-seq
MIRT1131931	hsa-miR-623	CLIP-seq
MIRT1131893	hsa-miR-646	CLIP-seq
MIRT1131932	hsa-miR-759	CLIP-seq
MIRT1131933	hsa-miR-761	CLIP-seq
MIRT1131896	hsa-miR-885-3p	CLIP-seq
MIRT1131897	hsa-miR-922	CLIP-seq
MIRT1131934	hsa-miR-93	CLIP-seq
MIRT1131830	hsa-miR-939	CLIP-seq
MIRT1131889	hsa-miR-5096	CLIP-seq
MIRT1131887	hsa-miR-487a	CLIP-seq
MIRT1131889	hsa-miR-5096	CLIP-seq
MIRT1131832	hsa-miR-1207-3p	CLIP-seq
MIRT1131838	hsa-miR-1324	CLIP-seq
MIRT1131839	hsa-miR-1470	CLIP-seq
MIRT1131847	hsa-miR-2467-3p	CLIP-seq
MIRT2037555	hsa-miR-3065-5p	CLIP-seq
MIRT2037556	hsa-miR-3130-5p	CLIP-seq
MIRT2037557	hsa-miR-3192	CLIP-seq
MIRT2037558	hsa-miR-320a	CLIP-seq
MIRT2037559	hsa-miR-320b	CLIP-seq
MIRT2037560	hsa-miR-320c	CLIP-seq
MIRT2037561	hsa-miR-320d	CLIP-seq
MIRT2037562	hsa-miR-330-3p	CLIP-seq
MIRT2037563	hsa-miR-4429	CLIP-seq
MIRT2037564	hsa-miR-4482	CLIP-seq
MIRT2037565	hsa-miR-4530	CLIP-seq
MIRT2037566	hsa-miR-4650-5p	CLIP-seq
MIRT1131879	hsa-miR-4667-3p	CLIP-seq
MIRT1131827	hsa-miR-4709-5p	CLIP-seq
MIRT1131828	hsa-miR-4728-5p	CLIP-seq
MIRT1131925	hsa-miR-4775	CLIP-seq
MIRT2037567	hsa-miR-505	CLIP-seq
MIRT1131889	hsa-miR-5096	CLIP-seq
MIRT1131891	hsa-miR-579	CLIP-seq
MIRT2037568	hsa-miR-766	CLIP-seq
MIRT2037569	hsa-miR-2861	CLIP-seq
MIRT2037570	hsa-miR-4269	CLIP-seq
MIRT2037571	hsa-miR-4514	CLIP-seq
MIRT2037565	hsa-miR-4530	CLIP-seq
MIRT2037572	hsa-miR-4692	CLIP-seq
MIRT2037573	hsa-miR-4742-5p	CLIP-seq
MIRT1131898	hsa-miR-940	CLIP-seq
MIRT1131832	hsa-miR-1207-3p	CLIP-seq
MIRT1131814	hsa-miR-1207-5p	CLIP-seq
MIRT2267495	hsa-miR-1231	CLIP-seq
MIRT2267496	hsa-miR-1237	CLIP-seq
MIRT2267497	hsa-miR-1248	CLIP-seq
MIRT1131837	hsa-miR-132	CLIP-seq
MIRT1131838	hsa-miR-1324	CLIP-seq
MIRT1131815	hsa-miR-181a	CLIP-seq
MIRT1131816	hsa-miR-181b	CLIP-seq
MIRT1131817	hsa-miR-181c	CLIP-seq
MIRT1131818	hsa-miR-181d	CLIP-seq
MIRT2267498	hsa-miR-1913	CLIP-seq
MIRT1131845	hsa-miR-2053	CLIP-seq
MIRT1131846	hsa-miR-212	CLIP-seq
MIRT1131909	hsa-miR-214	CLIP-seq
MIRT2267499	hsa-miR-22	CLIP-seq
MIRT1131847	hsa-miR-2467-3p	CLIP-seq
MIRT1131849	hsa-miR-27a	CLIP-seq
MIRT1131850	hsa-miR-27b	CLIP-seq
MIRT2037569	hsa-miR-2861	CLIP-seq
MIRT1131910	hsa-miR-3120-3p	CLIP-seq
MIRT2267500	hsa-miR-3125	CLIP-seq
MIRT1131819	hsa-miR-3150a-3p	CLIP-seq
MIRT1131820	hsa-miR-3175	CLIP-seq
MIRT2267501	hsa-miR-3179	CLIP-seq
MIRT1131853	hsa-miR-3184	CLIP-seq
MIRT2037557	hsa-miR-3192	CLIP-seq
MIRT2267502	hsa-miR-324-3p	CLIP-seq
MIRT2267503	hsa-miR-342-3p	CLIP-seq
MIRT1131855	hsa-miR-34a	CLIP-seq
MIRT2267504	hsa-miR-361-3p	CLIP-seq
MIRT1131821	hsa-miR-3616-3p	CLIP-seq
MIRT2267505	hsa-miR-3616-5p	CLIP-seq
MIRT1131915	hsa-miR-3619-5p	CLIP-seq
MIRT1131916	hsa-miR-3620	CLIP-seq
MIRT2267506	hsa-miR-3647-5p	CLIP-seq
MIRT2267507	hsa-miR-3689a-3p	CLIP-seq
MIRT2267508	hsa-miR-3689c	CLIP-seq
MIRT2267509	hsa-miR-377	CLIP-seq
MIRT2267510	hsa-miR-3913-3p	CLIP-seq
MIRT2267511	hsa-miR-3914	CLIP-seq
MIRT2267512	hsa-miR-3916	CLIP-seq
MIRT2267513	hsa-miR-3928	CLIP-seq
MIRT1131823	hsa-miR-421	CLIP-seq
MIRT1131859	hsa-miR-423-5p	CLIP-seq
MIRT2267514	hsa-miR-4252	CLIP-seq
MIRT1131824	hsa-miR-4262	CLIP-seq
MIRT2267515	hsa-miR-4265	CLIP-seq
MIRT2037570	hsa-miR-4269	CLIP-seq
MIRT2267516	hsa-miR-4287	CLIP-seq
MIRT2267517	hsa-miR-4296	CLIP-seq
MIRT1131861	hsa-miR-4302	CLIP-seq
MIRT2267518	hsa-miR-4314	CLIP-seq
MIRT2267519	hsa-miR-4322	CLIP-seq
MIRT2267520	hsa-miR-4417	CLIP-seq
MIRT2267521	hsa-miR-4420	CLIP-seq
MIRT1131865	hsa-miR-4426	CLIP-seq
MIRT1131825	hsa-miR-4436b-3p	CLIP-seq
MIRT2267522	hsa-miR-4453	CLIP-seq
MIRT2267523	hsa-miR-4457	CLIP-seq
MIRT2267524	hsa-miR-4468	CLIP-seq
MIRT2267525	hsa-miR-4469	CLIP-seq
MIRT1131870	hsa-miR-449a	CLIP-seq
MIRT1131871	hsa-miR-449b	CLIP-seq
MIRT2267526	hsa-miR-4504	CLIP-seq
MIRT2267527	hsa-miR-4505	CLIP-seq
MIRT2037571	hsa-miR-4514	CLIP-seq
MIRT2037565	hsa-miR-4530	CLIP-seq
MIRT2267528	hsa-miR-4538	CLIP-seq
MIRT2267529	hsa-miR-4646-5p	CLIP-seq
MIRT1131876	hsa-miR-4647	CLIP-seq
MIRT2267530	hsa-miR-4656	CLIP-seq
MIRT1131878	hsa-miR-4662b	CLIP-seq
MIRT2267531	hsa-miR-4663	CLIP-seq
MIRT2267532	hsa-miR-4677-3p	CLIP-seq
MIRT2267533	hsa-miR-4679	CLIP-seq
MIRT2267534	hsa-miR-4685-3p	CLIP-seq
MIRT2037572	hsa-miR-4692	CLIP-seq
MIRT1131881	hsa-miR-4697-3p	CLIP-seq
MIRT1131827	hsa-miR-4709-5p	CLIP-seq
MIRT2267535	hsa-miR-4710	CLIP-seq
MIRT1131828	hsa-miR-4728-5p	CLIP-seq
MIRT2267536	hsa-miR-4731-3p	CLIP-seq
MIRT1131923	hsa-miR-4738-3p	CLIP-seq
MIRT2267537	hsa-miR-4740-3p	CLIP-seq
MIRT2037573	hsa-miR-4742-5p	CLIP-seq
MIRT2267538	hsa-miR-4749-3p	CLIP-seq
MIRT2267539	hsa-miR-4757-5p	CLIP-seq
MIRT1131829	hsa-miR-4763-3p	CLIP-seq
MIRT1131926	hsa-miR-4797-3p	CLIP-seq
MIRT2267540	hsa-miR-4801	CLIP-seq
MIRT1131927	hsa-miR-4802-5p	CLIP-seq
MIRT2267541	hsa-miR-485-5p	CLIP-seq
MIRT2267542	hsa-miR-489	CLIP-seq
MIRT1131890	hsa-miR-513a-5p	CLIP-seq
MIRT2267543	hsa-miR-520a-5p	CLIP-seq
MIRT2267544	hsa-miR-525-5p	CLIP-seq
MIRT2267545	hsa-miR-542-3p	CLIP-seq
MIRT1131930	hsa-miR-548g	CLIP-seq
MIRT2267546	hsa-miR-550b	CLIP-seq
MIRT2267547	hsa-miR-563	CLIP-seq
MIRT2267548	hsa-miR-573	CLIP-seq
MIRT1131891	hsa-miR-579	CLIP-seq
MIRT2267549	hsa-miR-604	CLIP-seq
MIRT2267550	hsa-miR-615-3p	CLIP-seq
MIRT2267551	hsa-miR-624	CLIP-seq
MIRT2267552	hsa-miR-635	CLIP-seq
MIRT1131893	hsa-miR-646	CLIP-seq
MIRT1131933	hsa-miR-761	CLIP-seq
MIRT1131896	hsa-miR-885-3p	CLIP-seq
MIRT1131897	hsa-miR-922	CLIP-seq
MIRT1131830	hsa-miR-939	CLIP-seq
MIRT1131898	hsa-miR-940	CLIP-seq
MIRT2442344	hsa-miR-3617	CLIP-seq
MIRT2267510	hsa-miR-3913-3p	CLIP-seq
MIRT2442345	hsa-miR-3974	CLIP-seq
MIRT2442346	hsa-miR-4263	CLIP-seq
MIRT2442347	hsa-miR-4761-5p	CLIP-seq
MIRT2442348	hsa-miR-576-5p	CLIP-seq
MIRT2442349	hsa-miR-622	CLIP-seq
MIRT2442350	hsa-miR-641	CLIP-seq
MIRT1131839	hsa-miR-1470	CLIP-seq
MIRT2684609	hsa-miR-199a-5p	CLIP-seq
MIRT2684610	hsa-miR-199b-5p	CLIP-seq
MIRT2684611	hsa-miR-3151	CLIP-seq
MIRT1131861	hsa-miR-4302	CLIP-seq
MIRT2684612	hsa-miR-4447	CLIP-seq
MIRT2684613	hsa-miR-4472	CLIP-seq
MIRT1131879	hsa-miR-4667-3p	CLIP-seq
MIRT2684614	hsa-miR-491-5p	CLIP-seq

Show/Hide all(146)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000226	Process	Microtubule cytoskeleton organization	IDA	1057175
GO:0000226	Process	Microtubule cytoskeleton organization	NAS	28377597
GO:0001774	Process	Microglial cell activation	TAS	26363795
GO:0003677	Function	DNA binding	ISS
GO:0003677	Function	DNA binding	TAS	28386764
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	TAS	28386764
GO:0003690	Function	Double-stranded DNA binding	TAS	28386764
GO:0003697	Function	Single-stranded DNA binding	TAS	28386764
GO:0003723	Function	RNA binding	TAS	28386764
GO:0003779	Function	Actin binding	TAS	22920254, 27306859, 28386764
GO:0005515	Function	Protein binding	IPI	3111527, 7566652, 9689133, 10987820, 15953362, 16115884, 16275660, 16446437, 17078951, 17317006, 17932487, 18292230, 19138662, 19527721, 19647741, 20133804, 20655099, 21339331, 21692989, 21985244, 22303461, 22367970, 23399914, 23589030, 23666762, 24028865, 24098548, 24113872, 241653
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	28386764
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	28386764
GO:0005737	Component	Cytoplasm	IDA	23666762, 27356871
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	26014385, 27044754
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	TAS	28386764
GO:0005829	Component	Cytosol	IDA	10747907
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005874	Component	Microtubule	ISS
GO:0005886	Component	Plasma membrane	IDA	8522593, 10747907
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	28386764
GO:0006974	Process	DNA damage response	IMP	21131359
GO:0007267	Process	Cell-cell signaling	NAS	28386764
GO:0007416	Process	Synapse assembly	IMP	26704708
GO:0007611	Process	Learning or memory	IMP	26704708
GO:0007613	Process	Memory	IMP	20655099
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IDA	1918161, 28377597
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	IMP	10747907
GO:0008017	Function	Microtubule binding	NAS	28386764
GO:0008017	Function	Microtubule binding	TAS	26363795, 26609151
GO:0010288	Process	Response to lead ion	ISS
GO:0010506	Process	Regulation of autophagy	IGI	19074461
GO:0010629	Process	Negative regulation of gene expression	IMP	23164821
GO:0010917	Process	Negative regulation of mitochondrial membrane potential	IMP	22920254
GO:0015630	Component	Microtubule cytoskeleton	IDA	15147841, 27356871, 28377597
GO:0015630	Component	Microtubule cytoskeleton	NAS	26363795, 28386764
GO:0015631	Function	Tubulin binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	IMP	20655099
GO:0016072	Process	RRNA metabolic process	TAS	28386764
GO:0017124	Function	SH3 domain binding	IPI	9763511
GO:0019896	Process	Axonal transport of mitochondrion	TAS	26363795
GO:0019899	Function	Enzyme binding	IPI	9736630, 12888622, 20133804
GO:0019899	Function	Enzyme binding	ISS	23362255
GO:0019901	Function	Protein kinase binding	IPI	16923168, 24251416, 25556849
GO:0019901	Function	Protein kinase binding	ISS	17906291
GO:0021954	Process	Central nervous system neuron development	TAS	28386764
GO:0030424	Component	Axon	IDA	8642405
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	NAS	26363795
GO:0030424	Component	Axon	TAS	28386764
GO:0030425	Component	Dendrite	IDA	23666762, 25620700
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	IDA	8642405
GO:0030673	Component	Axolemma	IDA	10747907
GO:0030674	Function	Protein-macromolecule adaptor activity	TAS	28386764
GO:0031110	Process	Regulation of microtubule polymerization or depolymerization	IMP	27356871
GO:0031113	Process	Regulation of microtubule polymerization	NAS	1057175
GO:0031113	Process	Regulation of microtubule polymerization	TAS	10640627, 28386764
GO:0031116	Process	Positive regulation of microtubule polymerization	IDA	1421571, 7706316
GO:0031122	Process	Cytoplasmic microtubule organization	TAS	26363795
GO:0031175	Process	Neuron projection development	IBA
GO:0031175	Process	Neuron projection development	TAS	26363795
GO:0032930	Process	Positive regulation of superoxide anion generation	IMP	22920254
GO:0033044	Process	Regulation of chromosome organization	TAS	28386764
GO:0034063	Process	Stress granule assembly	TAS	28386764
GO:0034185	Function	Apolipoprotein binding	IPI	7566652
GO:0034399	Component	Nuclear periphery	IDA	19157893
GO:0034452	Function	Dynactin binding	TAS	26363795
GO:0034605	Process	Cellular response to heat	TAS	26363795
GO:0034614	Process	Cellular response to reactive oxygen species	TAS	28386764
GO:0035091	Function	Phosphatidylinositol binding	TAS	28386764
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0036477	Component	Somatodendritic compartment	IMP	20655099
GO:0036477	Component	Somatodendritic compartment	TAS	28386764
GO:0042802	Function	Identical protein binding	IDA	15654759
GO:0042802	Function	Identical protein binding	IMP	7929085, 14769047, 26014385
GO:0042802	Function	Identical protein binding	IPI	16446437, 17535890, 26436840, 27044754, 30158706, 30274285, 30894745
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043025	Component	Neuronal cell body	IMP	20655099
GO:0043197	Component	Dendritic spine	TAS	28386764
GO:0043565	Function	Sequence-specific DNA binding	TAS	28386764
GO:0044297	Component	Cell body	IDA	25620700
GO:0044297	Component	Cell body	ISS
GO:0044304	Component	Main axon	ISS
GO:0045121	Component	Membrane raft	ISS
GO:0045298	Component	Tubulin complex	IDA	8642405
GO:0045773	Process	Positive regulation of axon extension	IDA	1389180
GO:0046785	Process	Microtubule polymerization	IDA	26996940
GO:0046785	Process	Microtubule polymerization	TAS	26996940
GO:0048143	Process	Astrocyte activation	TAS	26363795
GO:0048167	Process	Regulation of synaptic plasticity	TAS	28386764
GO:0048312	Process	Intracellular distribution of mitochondria	IMP	21854751
GO:0048699	Process	Generation of neurons	NAS	8522593
GO:0050808	Process	Synapse organization	IMP	17270732
GO:0050848	Process	Regulation of calcium-mediated signaling	IDA	18272392
GO:0051087	Function	Protein-folding chaperone binding	IPI	25051234
GO:0051258	Process	Protein polymerization	IMP	27044754
GO:0051260	Process	Protein homooligomerization	IPI	26704708
GO:0051721	Function	Protein phosphatase 2A binding	TAS	26363795
GO:0051879	Function	Hsp90 protein binding	IPI	17517623
GO:0061564	Process	Axon development	TAS	26609151
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IMP	15147841
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	TAS	28386764
GO:0071813	Function	Lipoprotein particle binding	IPI	7972031
GO:0072386	Process	Plus-end-directed organelle transport along microtubule	TAS	26363795
GO:0090140	Process	Regulation of mitochondrial fission	IC	22367970
GO:0090258	Process	Negative regulation of mitochondrial fission	IMP	22920254
GO:0097386	Component	Glial cell projection	ISS
GO:0097418	Component	Neurofibrillary tangle	IDA	2484340
GO:0097418	Component	Neurofibrillary tangle	NAS	25620700
GO:0097435	Process	Supramolecular fiber organization	IDA	15654759
GO:0097435	Process	Supramolecular fiber organization	IMP	14769047
GO:0098930	Process	Axonal transport	NAS	28377597
GO:0098930	Process	Axonal transport	TAS	26363795
GO:0099077	Function	Histone-dependent DNA binding	TAS	28386764
GO:0099609	Function	Microtubule lateral binding	IMP	15147841
GO:1900034	Process	Regulation of cellular response to heat	IMP	21131359
GO:1900452	Process	Regulation of long-term synaptic depression	TAS	28386764
GO:1902474	Process	Positive regulation of protein localization to synapse	IMP	20655099
GO:1902936	Function	Phosphatidylinositol bisphosphate binding	TAS	28386764
GO:1902988	Process	Neurofibrillary tangle assembly	NAS	26363795
GO:1903748	Process	Negative regulation of establishment of protein localization to mitochondrion	IMP	22920254
GO:1903829	Process	Positive regulation of protein localization	IMP	27356871
GO:1904115	Component	Axon cytoplasm	IEA
GO:1904428	Process	Negative regulation of tubulin deacetylation	IGI	19457097
GO:1904428	Process	Negative regulation of tubulin deacetylation	TAS	28386764
GO:1990000	Process	Amyloid fibril formation	EXP	7929085, 14769047
GO:1990000	Process	Amyloid fibril formation	IDA	7929085, 14769047
GO:1990000	Process	Amyloid fibril formation	IEP	14769047
GO:1990000	Process	Amyloid fibril formation	IMP	7929085
GO:1990090	Process	Cellular response to nerve growth factor stimulus	TAS	28386764
GO:1990416	Process	Cellular response to brain-derived neurotrophic factor stimulus	TAS	28386764

MIM	HGNC	e!Ensembl
157140	6893	ENSG00000186868

Protein

UniProt ID

P10636

Protein name

Microtubule-associated protein tau (Neurofibrillary tangle protein) (Paired helical filament-tau) (PHF-tau)

Protein function

Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity (PubMed:21985311). The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components

PDB

1I8H , 2MZ7 , 2ON9 , 3OVL , 4E0M , 4E0N , 4E0O , 4FL5 , 4GLR , 4NP8 , 4TQE , 4Y32 , 4Y3B , 4Y5I , 5DMG , 5E2V , 5E2W , 5HF3 , 5K7N , 5MO3 , 5MP1 , 5MP3 , 5MP5 , 5N5A , 5N5B , 5NVB , 5O3L , 5O3O , 5O3T , 5V5B , 5V5C , 5ZIA , 5ZV3 , 6BB4 , 6CVJ , 6CVN , 6DC8 , 6DC9 , 6DCA , 6FBW , 6FI5 , 6GK7 , 6GK8 , 6GX5 , 6H06 , 6HRE , 6HRF , 6LRA , 6N4P , 6NK4 , 6NWP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00418	Tubulin-binding	561 → 591	Tau and MAP protein, tubulin-binding repeat	Family
PF00418	Tubulin-binding	592 → 622	Tau and MAP protein, tubulin-binding repeat	Family
PF00418	Tubulin-binding	623 → 653	Tau and MAP protein, tubulin-binding repeat	Family
PF00418	Tubulin-binding	654 → 685	Tau and MAP protein, tubulin-binding repeat	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in neurons. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system.

Sequence

MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPG
SETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAG
HVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEG
GRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPA
QDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPA
AAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQK
GQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREP
KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEK
LDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDT
SPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

Sequence length

758

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Alzheimer disease Parkinson disease Pathways of neurodegeneration - multiple diseases		Caspase-mediated cleavage of cytoskeletal proteins

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Frontotemporal dementia	frontotemporal dementia	rs63750092, rs1598408336, rs1568327531, rs63749974, rs63750570, rs63750568, rs63750756, rs63750013, rs63751165, rs63751394, rs63750512, rs63750308, rs63751438, rs63751011, rs63750912 View all (9 more)	N/A
Parkinson disease	parkinson disease, late-onset	rs63751392	N/A
alzheimer disease	Alzheimer disease	rs1568339995	N/A

Show/Hide Unknown Diseases (13)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
Biliary Cirrhosis	Primary biliary cirrhosis	N/A	N/A	GWAS
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Corticobasal Degeneration	Corticobasal degeneration	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Diabetes	Type 1 diabetes	N/A	N/A	GWAS
Dyslexia	Dyslexia	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
multiple system atrophy	Multiple system atrophy	N/A	N/A	ClinVar
Neuroticism	Neuroticism	N/A	N/A	GWAS
Pica	Pick disease	N/A	N/A	GenCC
Progressive Supranuclear Palsy	Progressive supranuclear palsy	N/A	N/A	GWAS
Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (299)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	14997933, 24112793, 27834776, 29053874, 29435558, 30021611, 31175300, 31495601, 32161412, 32620704, 32808011, 32960680, 33439987, 33443136, 34002449 View all (9 more)
Abnormalities Drug Induced	Associate	17712160, 31585367, 37485642, 8919303
Absent radii and thrombocytopenia	Associate	40318118
Acquired CJD	Associate	16361602
Actin Accumulation Myopathy	Associate	12023276
Adenocarcinoma	Associate	37010714
Aging Premature	Associate	37110517
Agraphia	Associate	23121543
Alcohol Amnestic Disorder	Associate	34588422
Alzheimer Disease	Associate	10037497, 10214944, 10599054, 10805776, 10840038, 11013236, 11303790, 11438574, 11852060, 12023276, 12032355, 12065626, 12414518, 12580546, 12801934 View all (760 more)
Alzheimer Disease	Stimulate	17400380, 19494431, 19746990, 20414590, 20570401, 21971452, 25212463, 26328896, 27459603, 28641921, 29402979, 30735395, 30830207, 31167810, 32485097 View all (7 more)
Alzheimer Disease	Inhibit	31068645
Alzheimer Disease 15	Associate	11852060, 12882323, 15733856, 16472737, 17680984, 18431250, 18803694, 20974297, 21577325, 22033876, 23018443, 26655600, 31450505, 33571490, 33915734, 8129042, 8570627 View all (2 more)
Alzheimer's disease without Neurofibrillary tangles	Associate	10214944, 12756133, 18322394, 22039833, 23371364, 23550703, 24453187, 25775228, 27115769, 28087578, 30573872, 31450505, 34426645, 36533443, 38605589
Alzheimer's disease without Neurofibrillary tangles	Stimulate	30508025, 38174587
Amnesia	Associate	26297556
Amyloid angiopathy	Associate	8570627
Amyloidosis	Associate	34342183, 35617280
Amyotrophic Lateral Sclerosis	Associate	19046355, 24086518, 28077166, 29630712, 31131395, 34779076, 36952379, 38002967
Amyotrophic lateral sclerosis 1	Associate	20558945, 31131395
Anomia	Associate	35348856
Anxiety	Associate	35917404, 37806671
Aphasia	Associate	29113604, 36001141
Aphasia	Stimulate	37485642
Aphasia Broca	Associate	27529406, 38007664
Aphasia Primary Progressive	Associate	23518664, 25765123, 27529406, 28747523, 29113604, 29514947, 29935044, 30599136, 30656179, 31350322, 31848674, 32391858, 33622418, 34418401, 34494711 View all (5 more)
Apnea	Stimulate	24439479
Apraxias	Associate	29935044, 29969053, 38007664
Arteriolosclerosis	Associate	35044500
Arthritis Rheumatoid	Associate	28586827
Astrocytoma	Associate	31866416
Ataxia	Associate	24086518
Ataxia Telangiectasia	Associate	37569528
Atrophy	Associate	19255408, 19786698, 20045477, 21753165, 21908872, 23043292, 25448043, 25574752, 26507310, 26843008, 28160067, 28241163, 29793546, 30086796, 31200149 View all (24 more)
Attention Deficit and Disruptive Behavior Disorders	Stimulate	31915189
Attention Deficit Disorder with Hyperactivity	Associate	27357347
Auditory Perceptual Disorders	Stimulate	36538154
Autism Spectrum Disorder	Associate	31511657, 37907504
Autoimmune Diseases	Associate	40132252
Autonomic Nervous System Diseases	Associate	38134678
Basal Ganglia Diseases	Associate	28133816, 28939709, 35799292
Brain Concussion	Associate	32097865, 35627205
Brain Damage Chronic	Associate	36516115, 38544341
Brain Diseases	Associate	15489396, 21685912, 21753165, 26556772, 31653847, 33247623, 33955002, 34742335, 35352105, 40437880
Brain Diseases	Stimulate	20570401, 21971452
Brain Injuries	Associate	39314520
Brain Injuries Traumatic	Associate	26556772, 30901365, 31484787
Brain Injuries Traumatic	Stimulate	29717219
Brain Neoplasms	Associate	30700265, 35229396, 37894731
Brain Stem Neoplasms	Associate	35422444, 38605589
Breast Neoplasms	Associate	15914550, 16721363, 17404087, 20228842, 20579400, 21062914, 21679412, 22976542, 23446558, 25725586, 27221882, 30700265, 34406386, 35990656, 37110517, 38251461 View all (1 more)
Calcinosis	Associate	28087578
Calcium Metabolism Disorders	Associate	30840313
Carcinoma Non Small Cell Lung	Associate	37079439
Carcinoma Ovarian Epithelial	Associate	23631819, 25658796, 30559148
Carcinoma Renal Cell	Associate	18065436, 29215599
Cardiovascular Diseases	Associate	25574752
Cell Transformation Neoplastic	Associate	29328367
Central Nervous System Infections	Associate	34846537
Cerebellar Diseases	Associate	36895129
Cerebral Amyloid Angiopathy	Associate	19743453, 26988843, 34128081
Cerebral Palsy	Associate	26988843
Cerebral Small Vessel Diseases	Associate	35044500
Cerebrospinal Fluid Rhinorrhea	Stimulate	33843981
Chromosome 17q21.31 Deletion Syndrome	Associate	18628315, 21094706
Chromosome Aberrations	Associate	36599286
Chronic Traumatic Encephalopathy	Associate	25867769, 26518018, 26556772, 26998921, 27885490, 29145658, 29338612, 30563563, 30573872, 32500646, 33980303, 34128081, 34172091, 34588692, 34626223, 37803326, 40239644 View all (2 more)
Ciliary Dyskinesia With Transposition Of Ciliary Microtubules	Associate	25128526, 33772783
Clinical Deterioration	Associate	37806671
Cognition Disorders	Associate	16478530, 17428800, 18803694, 19046355, 19420940, 20862329, 22039833, 22595371, 23562540, 25088003, 25596881, 26843008, 27061069, 27697694, 27832767 View all (68 more)
Cognition Disorders	Stimulate	26791227, 37673381
Cognitive Dysfunction	Associate	19420940, 22911757, 23613741, 25751166, 26682693, 27459603, 28133816, 30014553, 31211344, 31410194, 31653847, 32955460, 33215319, 33682714, 34399127, 35694921, 39955563 View all (2 more)
Cognitive Dysfunction	Stimulate	36538154, 37742656
Colitis Ulcerative	Associate	28586827
Connective Tissue Diseases	Associate	29634760
Corticobasal Degeneration	Associate	10037497, 10209184, 12057909, 12435607, 15792962, 17602795, 18854867, 19001166, 21823158, 22027014, 22556362, 22595371, 22723018, 22862741, 22950410 View all (43 more)
COVID 19	Associate	37286376, 37775022
Craniocerebral Trauma	Associate	34172091
Creutzfeldt Jakob Disease Sporadic	Associate	20686702, 22016658, 27852982, 33883011, 34782343
Creutzfeldt Jakob Syndrome	Inhibit	12933920
Creutzfeldt Jakob Syndrome	Stimulate	16361602
Creutzfeldt Jakob Syndrome	Associate	20686702, 27377321, 27929120, 33674752, 34487324, 35233692
Crohn Disease	Associate	28586827
Cytomegalovirus Infections	Associate	22366796
Death	Associate	16495230, 26426266, 26990251, 30373672, 36895005
Delusional Parasitosis	Associate	24135712
Dementia	Associate	10805746, 11826152, 12435607, 14685691, 15020716, 15611092, 16495230, 16777844, 16782711, 17023423, 18431250, 18852354, 18940799, 20805522, 20862329 View all (58 more)
Dementia	Stimulate	39235525
Dementia Vascular	Associate	16191223
Dental Plaque	Stimulate	32975239
Depressive Disorder	Associate	24135712, 29353234, 34024836, 37258256, 40435794
Developmental Disabilities	Associate	32393582
Diabetes Mellitus	Associate	19659459, 31305320
Diabetes Mellitus Type 1	Associate	33832546
Diabetes Mellitus Type 2	Associate	19659459, 35334221
Diffuse Axonal Injury	Stimulate	30901365
Diffuse Cerebral Sclerosis of Schilder	Associate	19255408, 19786698, 29172163
Diffuse Cerebral Sclerosis of Schilder	Stimulate	19299900
Diffuse Neurofibrillary Tangles with Calcification	Associate	10214944, 10840038, 11013236, 11159174, 11852060, 12588928, 12801934, 12882323, 14511120, 14997933, 15356202, 15559752, 16107349, 16687396, 16782711 View all (121 more)
Diffuse Neurofibrillary Tangles with Calcification	Stimulate	21205220, 21515431, 23053135, 24598588, 32182160
Disease	Associate	22723018, 31433871, 34689836, 34874463, 37000265
Disruptive Impulse Control and Conduct Disorders	Associate	39334114
Distal myopathy Nonaka type	Associate	32756195, 9546349
DNA Virus Infections	Associate	33811272
Down Syndrome	Associate	12853572, 18430997, 21573099, 22344463, 30902060, 30909239, 32192521, 33070299, 33380426, 35194165, 38631766, 40595720, 40667715
Drug Related Side Effects and Adverse Reactions	Associate	18672021, 24063855, 24292008, 33930029, 38189521
Drug Resistant Epilepsy	Associate	27435091
Encephalitis	Associate	34210823
Epilepsy	Associate	27435091, 27859539, 29634760, 38289539
Epilepsy Familial Mesial Temporal Lobe	Associate	24069608
Epilepsy Frontal Lobe	Associate	33568215
Epilepsy Temporal Lobe	Associate	19786698, 22284815, 25363208, 27357347, 28319241, 30711674, 31834353, 31870644, 34158384, 39337715
Essential Tremor	Associate	22911817, 34363663, 36183486
Familial progressive supranuclear palsy	Associate	11861703, 16157753
Fever	Inhibit	40724923
Folate Malabsorption Hereditary	Stimulate	25651436
Fractures Bone	Associate	27080260
Fractures Spontaneous	Associate	35694921
Frontotemporal Dementia	Associate	10037497, 10209184, 10214944, 10318930, 10359094, 10393977, 10561502, 10805746, 11078890, 11159174, 11571213, 11861703, 11906000, 12023276, 12198126 View all (234 more)
Frontotemporal Dementia	Stimulate	30698757
Frontotemporal Lobar Degeneration	Associate	16421130, 17021754, 18166610, 18183624, 18234697, 18420483, 18803694, 19091059, 19255408, 19299900, 19455346, 19746990, 20045477, 20490813, 20838030 View all (76 more)
Frontotemporal Lobar Degeneration	Inhibit	18458217
Genetic Diseases Inborn	Associate	26426266, 30014553, 30831384, 35099506, 38605589, 40411302
Gerstmann Straussler Scheinker Disease	Associate	28466265, 30373672, 34128081, 34487324, 9285466
Glaucoma Open Angle	Associate	37201334
Glioblastoma	Associate	31311947, 35229396, 37894731
Glioma	Associate	23020756
Gliosis	Associate	18065436
Gliosis	Inhibit	27435172
Glucose Intolerance	Associate	26962052
Glucose Metabolism Disorders	Stimulate	19451179
Glutamate Monosodium Sensitivity	Inhibit	27013866
Gray Platelet Syndrome	Associate	20045477, 30753379, 33622418
Hallucinations	Associate	39658879
Hearing Loss	Associate	36356475
Heart Diseases	Associate	29082658, 33093220, 34002449, 34314701, 35483895, 38174587
Heart Diseases	Inhibit	32842621
Heart Failure Diastolic	Associate	25363208
Hemimegalencephaly	Associate	23319189
Heredodegenerative Disorders Nervous System	Associate	11710889, 12649279, 23925123, 30235682, 30382371, 32575375, 32589925
Hippocampal Sclerosis	Associate	28189700
HIV Infections	Associate	27535703
Huntington Disease	Associate	25953777, 27344050, 27651306, 28241046, 29474427, 30573872, 31358058, 38544341, 40256911
Hydrocephalus	Stimulate	28212403
Hydrocephalus Normal Pressure	Associate	31849332
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	36073820
Hyperkinesis	Associate	35246269
Hypokinesia	Associate	24514572, 27458716
Hypotension Orthostatic	Associate	32767721
Hypoxia	Associate	29215599
Immunologic Deficiency Syndromes	Associate	26825611, 27435091, 27435172
Inferior Wall Myocardial Infarction	Associate	24656848
Inflammation	Associate	21212632, 23943781, 33536571, 34209408, 36267464, 37280592, 37730697, 38507186, 40187909
Inflammation	Stimulate	31915256, 33682714, 33724164, 37510227
Insomnia Fatal Familial	Stimulate	34487324
Insomnia Fatal Familial	Associate	39716111
Insulin Resistance	Associate	22536436, 27079723, 33267804, 33832546
Intellectual Disability	Associate	20395263
Kidney Failure Chronic	Associate	31950334
Language Disorders	Associate	18322394, 31870644, 31999351, 37348248
Learning Disabilities	Associate	22950410
Leprosy	Associate	7943169
Leukoencephalopathies	Associate	31585367, 33622418, 35358703, 35799292, 36965457
Lewy Body Disease	Associate	24086518, 25575135, 26333800, 26756745, 26923020, 28077166, 28269775, 28395086, 30448004, 31165862, 31234228, 32561678, 32989106, 33631469, 34308904, 34514546, 36443011, 39658879, 9811326 View all (4 more)
Lewy Body Disease	Inhibit	32842621
limbic predominant age related TDP 43 encephalopathy	Associate	25574752, 34852950
Livedoid Vasculopathy	Associate	28133816
Long QT Syndrome	Associate	27390944
Machado Joseph Disease	Associate	22023810
Malformations of Cortical Development	Associate	31200149, 34373896
Malformations of Cortical Development Group I	Associate	31646584
Memory Disorders	Associate	20862329, 22911757, 23121543, 25960448, 27357347, 30563962, 30992433, 31653847, 32367269, 34158479, 35008592, 35348856, 35670275, 35917404, 36707904, 38134678 View all (1 more)
Memory Disorders	Stimulate	33857770, 39670385
Menopause Premature	Associate	35471588
Mental Disorders	Associate	23325909, 27529406, 30373672, 32228870, 36474176
Metabolic Diseases	Associate	31642932
Microphthalmia Syndromic 10	Associate	20045477, 25683866, 28130473, 34021244, 35099506, 36356475, 36707904, 37670234, 37749258
Microphthalmia Syndromic 10	Stimulate	20570401
Mitochondrial complex I deficiency	Inhibit	25402454
Mitochondrial Diseases	Associate	22424094, 26198711, 30683981, 31536662, 34779076, 37408218
Mitochondrial Diseases	Stimulate	27594585, 36982371
Mood Disorders	Associate	32769115, 37806671
Motor Neuron Disease	Associate	18800011, 19884572, 27036121, 34274155
Movement Disorders	Associate	25900293, 31234228
Multiple Sclerosis	Associate	36221144
Multiple System Atrophy	Associate	26333800, 27374978, 27629089, 28077166, 34255887, 35485527
Muscle Spasticity	Associate	20629132
Muscle Weakness	Associate	15385569
Muscular Atrophy Spinal	Associate	31123861
Muscular Diseases	Associate	32756195, 7992832
Muscular Disorders Atrophic	Associate	20620666
Muscular Dystrophy Duchenne	Associate	24222227
Mutism	Associate	15489396
Myoclonus	Associate	30996196
Myopathy Granulovacuolar Lobular with Electrical Myotonia	Associate	24533944, 39955563
Myositis Inclusion Body	Associate	14695312, 16441512, 24462217, 25978849, 32756195, 8577761
Myotonic Dystrophy	Associate	16487687, 19166838, 21439371, 24440524, 25702800, 33955002
Neointima	Associate	28819146
Neoplasm Metastasis	Associate	20228842, 37010714
Neoplasms	Associate	15914550, 20228842, 28947735, 28974363, 29794074, 30394813, 30700265, 30823906, 35925417, 37000265, 37353565, 37730697, 37894731, 37953365
Neoplastic Syndromes Hereditary	Associate	27345788, 27345789, 27345791
Nerve Degeneration	Associate	10037497, 15020716, 16495230, 18940799, 19451179, 19623258, 20817151, 21212632, 22039833, 22253473, 22927204, 24292008, 24319659, 24899730, 25912737 View all (28 more)
Nerve Degeneration	Stimulate	23145103, 24252534, 24598588, 29228211, 30318785
Nervous System Diseases	Associate	21398043, 24346801, 25535399, 25574752, 27115769, 30136084
Neuroaxonal Dystrophies	Associate	24252552
Neurobehavioral Manifestations	Associate	25596881, 27061069, 31953922, 35358831
Neuroblastoma	Associate	18239850, 18672021, 20930284, 21127069, 27266855, 27548710, 30124450, 30394813, 32427887, 33934221, 36830589, 8468346, 8919303
Neurocognitive Disorders	Associate	25880550, 40665403
Neurodegenerative Diseases	Associate	10037497, 10209184, 10214944, 10737634, 12032355, 12358741, 12756133, 14695329, 15020716, 15190058, 15611092, 16464864, 16495230, 16782711, 16943417 View all (183 more)
Neurodegenerative Diseases	Inhibit	35008438
Neuroinflammatory Diseases	Associate	21212632, 30847369, 32951237, 36974379, 37995336
Neurologic Manifestations	Associate	22535953, 26923020, 27449489, 28594853, 29476081, 32812023, 34965173, 35063084, 35610289
Neurologic Manifestations	Stimulate	34057756
Neuronal intestinal pseudoobstruction	Associate	12580546, 23371364, 24577470, 34588692
Neurotoxicity Syndromes	Associate	14511120, 21127069, 23421912, 25535399, 25953777, 26208804, 35202653, 36830589, 37353565, 40363838
Neutrophil Immunodeficiency Syndrome	Stimulate	37280592
Niemann Pick Disease Type C	Stimulate	21205675
Niemann Pick Disease Type C	Associate	33672048
Night blindness congenital stationary	Associate	25912737, 26791227
Obesity	Associate	29115457
Oculomotor Nerve Diseases	Stimulate	35790423
Olfaction Disorders	Associate	27855167, 35694921
Olivopontocerebellar Atrophies	Associate	21681797, 26373282, 9789048
Opitz GBBB Syndrome X Linked	Associate	40363838
Osteitis Deformans	Associate	19925894
Osteoporosis	Associate	28340083, 32155994
Ovarian Neoplasms	Associate	25658796
Panic Disorder	Associate	29353234
Pantothenate Kinase Associated Neurodegeneration	Associate	22416811
Parkinson Disease	Associate	11710889, 14966169, 15792962, 17514749, 18509094, 18854867, 18985386, 19558713, 19912324, 20070850, 20127702, 20599975, 20683486, 21058943, 21127069 View all (84 more)
Parkinson Disease	Inhibit	27288043, 27336847
Parkinson Disease 10	Associate	33319314
Parkinson Disease 12	Associate	20629132
Parkinson Disease Familial Type 1	Associate	26297556
Parkinson Disease Secondary	Associate	10214944, 18509094, 20127702, 20629132, 21892619, 22595371, 22623900, 23727082, 24135712, 24514572, 24842889, 26295349, 26426266, 27458716, 27529406 View all (13 more)
Parkinsonian Disorders	Associate	25899925, 32854784
Parkinsonism Dystonia Infantile	Associate	20619503
Pathologic Processes	Associate	23145103
Pediatric acute onset neuropsychiatric syndrome	Associate	32228870, 39394562
Perceptual Disorders	Associate	20561037
Peri Implantitis	Associate	34858391, 36267464
Personality Disorders	Associate	28268100, 36171642
Pick Disease of the Brain	Associate	10037497, 11299448, 12435607, 16006664, 20535063, 22009441, 24086739, 24135712, 24252534, 26426266, 26583316, 27529406, 27911827, 28077166, 28087578 View all (14 more)
Plaque Amyloid	Associate	10318930, 18541914, 20437581, 22261556, 25128526, 26293308, 26402409, 27532054, 28087578, 34873815, 34874463, 36959205, 38037144, 39913635
Pneumothorax	Associate	19912324, 24086739, 24121548, 27997036, 28009087, 31059154, 34363663, 40618089
Polyradiculoneuropathy	Associate	31953922
Postural Orthostatic Tachycardia Syndrome	Stimulate	28332604
Primary Progressive Nonfluent Aphasia	Associate	17712160, 21908872, 23518664, 29440230, 29627938
Primary Progressive Nonfluent Aphasia	Stimulate	23718879
Prion Diseases	Associate	21416485, 27893164, 31953922, 33883011, 35288744, 36221144, 36952379
Prion Diseases	Stimulate	33674752, 34035398
Progressive supranuclear palsy atypical	Associate	16495230, 17675576
Prostatic Neoplasms	Associate	19681044, 30823906, 32568785, 33811272, 37000265, 37108754
Protein Aggregation Pathological	Associate	32291284
Proteostasis Deficiencies	Associate	36974379, 40401628
Proteostasis Deficiencies	Stimulate	37685887
Psychotic Disorders	Associate	21093110, 24069608, 24731519
REM Sleep Behavior Disorder	Associate	32767721, 32989106
Respiratory Insufficiency	Associate	30996196
Restless Legs Syndrome	Associate	32767721
Retinal Dystrophies	Associate	32842621, 36112222
Retinitis	Associate	39955563
Retrograde Degeneration	Inhibit	27435172
Retrograde Degeneration	Stimulate	28269775
Retrograde Degeneration	Associate	32367269, 32812023, 34873815, 35670275, 35917404, 40640137
Schizophrenia	Associate	27287230, 31504236
Scleroderma Systemic	Associate	26792595
Signs and Symptoms	Associate	39284109
Sjogren's Syndrome	Associate	35896530
Sleep Apnea Obstructive	Associate	39456840
Sleep Apnea Syndromes	Associate	24439479
Sleep Wake Disorders	Associate	32769115, 35491776, 37280592, 39527773
Social Communication Disorder	Associate	26583316
Spastic Paraplegia Hereditary	Associate	26506339
Speech Disorders	Associate	23325909
Stomach Neoplasms	Associate	16721363, 23446558, 38062820
Stress Disorders Post Traumatic	Associate	29634760
Substance Related Disorders	Associate	27601475
Supranuclear Palsy Progressive	Associate	10037497, 10209184, 11861703, 14707330, 15792962, 16157753, 17357082, 17602795, 18315566, 18854867, 19001166, 19912324, 20838030, 21685912, 21908872 View all (90 more)
Supranuclear Palsy Progressive	Stimulate	17675576
Syndactyly type 3	Stimulate	38631765
Synucleinopathies	Associate	26333800, 31165862, 34426604, 36906636, 37131250, 38134678
Tauopathies	Associate	12435607, 12649279, 12853572, 14757934, 15611092, 15792962, 16777844, 17266954, 18065436, 18322396, 18541914, 19001166, 19010781, 19091059, 19919107 View all (155 more)
Tauopathies	Stimulate	24086754, 32050258, 32208437, 32427887
TDP 43 Proteinopathies	Associate	27036121
Telomeric 22q13 Monosomy Syndrome	Associate	37670319
Thinness	Associate	35584575
tinea nigra	Associate	38605589
Tooth Loss	Associate	30010122
Torsades de Pointes	Associate	29514947, 29554190, 29926172
Tremor	Associate	20561037, 37746582
Tremor	Stimulate	28332604
Urinary Bladder Neurogenic	Associate	33804213
Ventricular Fibrillation	Associate	27080260, 32291284
Vision Disorders	Associate	32762790
Voice Disorders	Associate	26297556
Vulvar Neoplasms	Associate	21935479
Weight Loss	Associate	36895129
Wounds and Injuries	Associate	30573872

MAPT (microtubule associated protein tau)