Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4129
Gene name Gene Name - the full gene name approved by the HGNC.	Monoamine oxidase B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAOB
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp11.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabo

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT536189	hsa-miR-335-5p	PAR-CLIP	22012620
MIRT536188	hsa-miR-4426	PAR-CLIP	22012620
MIRT536187	hsa-miR-4647	PAR-CLIP	22012620
MIRT536186	hsa-miR-4662b	PAR-CLIP	22012620
MIRT536185	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT536184	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT536183	hsa-miR-628-5p	PAR-CLIP	22012620
MIRT536189	hsa-miR-335-5p	PAR-CLIP	22012620
MIRT536188	hsa-miR-4426	PAR-CLIP	22012620
MIRT536187	hsa-miR-4647	PAR-CLIP	22012620
MIRT536186	hsa-miR-4662b	PAR-CLIP	22012620
MIRT536185	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT536184	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT536183	hsa-miR-628-5p	PAR-CLIP	22012620
MIRT1127646	hsa-miR-1185	CLIP-seq
MIRT1127647	hsa-miR-1252	CLIP-seq
MIRT1127648	hsa-miR-2114	CLIP-seq
MIRT1127649	hsa-miR-3173-3p	CLIP-seq
MIRT1127650	hsa-miR-3679-5p	CLIP-seq
MIRT1127651	hsa-miR-4270	CLIP-seq
MIRT1127652	hsa-miR-4441	CLIP-seq
MIRT1127653	hsa-miR-4474-3p	CLIP-seq
MIRT1127654	hsa-miR-599	CLIP-seq
MIRT1127655	hsa-miR-760	CLIP-seq
MIRT2266488	hsa-miR-3650	CLIP-seq
MIRT2438474	hsa-miR-490-5p	CLIP-seq
MIRT2438475	hsa-miR-511	CLIP-seq
MIRT2453644	hsa-miR-3125	CLIP-seq
MIRT2453645	hsa-miR-3613-3p	CLIP-seq
MIRT2453646	hsa-miR-3916	CLIP-seq
MIRT2453647	hsa-miR-4668-3p	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
CDCA7L	Repression	20980443
EAPP	Repression	20980443
RARA	Unknown	19401466
SP1	Unknown	11259630;20980443
SP3	Unknown	11259630
SP4	Activation	11259630

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 30021884, 32296183, 32814053, 33961781
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005740	Component	Mitochondrial envelope	TAS	7063850
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS	24252804
GO:0008131	Function	Primary methylamine oxidase activity	IBA
GO:0008131	Function	Primary methylamine oxidase activity	IDA	20493079
GO:0008131	Function	Primary methylamine oxidase activity	IEA
GO:0008131	Function	Primary methylamine oxidase activity	ISS
GO:0009055	Function	Electron transfer activity	TAS	8602220
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0042420	Process	Dopamine catabolic process	IEA
GO:0042420	Process	Dopamine catabolic process	TAS	24252804
GO:0050660	Function	Flavin adenine dinucleotide binding	IBA
GO:0050665	Process	Hydrogen peroxide biosynthetic process	NAS	24252804
GO:0097621	Function	Monoamine oxidase activity	IDA	20493079
GO:0097621	Function	Monoamine oxidase activity	IEA

MIM	HGNC	e!Ensembl
309860	6834	ENSG00000069535

Protein

UniProt ID

P27338

Protein name

Amine oxidase [flavin-containing] B (EC 1.4.3.21) (EC 1.4.3.4) (Monoamine oxidase type B) (MAO-B)

Protein function

Catalyzes the oxidative deamination of primary and some secondary amines such as neurotransmitters, and exogenous amines including the tertiary amine, neurotoxin 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP), with concomitant reduction of

PDB

1GOS , 1OJ9 , 1OJA , 1OJC , 1OJD , 1S2Q , 1S2Y , 1S3B , 1S3E , 2BK3 , 2BK4 , 2BK5 , 2BYB , 2C64 , 2C65 , 2C66 , 2C67 , 2C70 , 2C72 , 2C73 , 2C75 , 2C76 , 2V5Z , 2V60 , 2V61 , 2VRL , 2VRM , 2VZ2 , 2XCG , 2XFN , 2XFO , 2XFP , 2XFQ , 2XFU , 3PO7 , 3ZYX , 4A79 , 4A7A , 4CRT , 5MRL , 6FVZ , 6FW0 , 6FWC , 6RKB , 6RKP , 6RLE , 6YT2 , 7B0V , 7B0Z , 7P4F , 7P4H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01593	Amino_oxidase	14 → 451	Flavin containing amine oxidoreductase	Domain

Sequence

MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV

Sequence length

520

Interactions

View interactions

	KEGG		Reactome
	Glycine, serine and threonine metabolism Arginine and proline metabolism Histidine metabolism Tyrosine metabolism Phenylalanine metabolism Tryptophan metabolism Drug metabolism - cytochrome P450 Metabolic pathways Serotonergic synapse Dopaminergic synapse Parkinson disease Cocaine addiction Amphetamine addiction Alcoholism		Biogenic amines are oxidatively deaminated to aldehydes by MAOA and MAOB

MAOB (monoamine oxidase B)