MAL (mal, T cell differentiation protein (MAL blood group))

Gene

• Entrez ID: 4118
• Gene name: Mal, T cell differentiation protein (MAL blood group)
• Gene symbol: MAL
• Synonyms (NCBI Gene): HLD28, MVP17, VIP17
• Chromosome: 2
• Chromosome location: 2q11.1
• Summary: The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal trans

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001766	Process	Membrane raft polarization	TAS	12153479
GO:0002175	Process	Protein localization to paranode region of axon	IEA
GO:0005515	Function	Protein binding	IPI	21988832, 22366891, 25416956, 31515488, 32296183, 35217805
GO:0005783	Component	Endoplasmic reticulum	IDA	8132541
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	NAS
GO:0007417	Process	Central nervous system development	TAS	10739088
GO:0008289	Function	Lipid binding	TAS	10739088
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	TAS	10739088
GO:0016505	Function	Peptidase activator activity involved in apoptotic process	NAS
GO:0019911	Function	Structural constituent of myelin sheath	IBA
GO:0019911	Function	Structural constituent of myelin sheath	IDA	12153479
GO:0019911	Function	Structural constituent of myelin sheath	IEA
GO:0022010	Process	Central nervous system myelination	IEA
GO:0030154	Process	Cell differentiation	TAS	10739088
GO:0042552	Process	Myelination	IBA
GO:0042552	Process	Myelination	IEA
GO:0042552	Process	Myelination	NAS	12153479
GO:0042552	Process	Myelination	TAS	10428054
GO:0043220	Component	Schmidt-Lanterman incisure	IEA
GO:0044853	Component	Plasma membrane raft	IEA
GO:0045121	Component	Membrane raft	IDA	12153479, 23264465
GO:0045121	Component	Membrane raft	IEA
GO:0045176	Process	Apical protein localization	TAS	10739088
GO:0098737	Process	Protein insertion into plasma membrane	IEA
GO:0098737	Process	Protein insertion into plasma membrane	IMP	35217805
GO:0120003	Component	Hinge region between urothelial plaques of apical plasma membrane	IEA
GO:1902043	Process	Positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA

Other IDs

• MIM: 188860
• HGNC: 6817
• e!Ensembl: ENSG00000172005

Protein

• UniProt ID: P21145
• Protein name: Myelin and lymphocyte protein (T-lymphocyte maturation-associated protein)
• Protein function: May be involved in vesicular trafficking from the Golgi apparatus to the cell membrane. Plays a role in the maintenance of the myelin sheath, and in axon-glia and glia-glia interactions.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01284	MARVEL	18 → 145	Membrane-associating domain	Domain

• Sequence:

  MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSV
  FCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYR
  HYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS

• Sequence length: 153