Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4118
Gene name Gene Name - the full gene name approved by the HGNC.	Mal, T cell differentiation protein (MAL blood group)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAL
Synonyms (NCBI Gene) Gene synonyms aliases	HLD28, MVP17, VIP17
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q11.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal trans

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001766	Process	Membrane raft polarization	TAS	12153479
GO:0002175	Process	Protein localization to paranode region of axon	IEA
GO:0005515	Function	Protein binding	IPI	21988832, 22366891, 25416956, 31515488, 32296183, 35217805
GO:0005783	Component	Endoplasmic reticulum	IDA	8132541
GO:0005886	Component	Plasma membrane	IEA
GO:0006915	Process	Apoptotic process	NAS
GO:0007417	Process	Central nervous system development	TAS	10739088
GO:0008289	Function	Lipid binding	TAS	10739088
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	TAS	10739088
GO:0016505	Function	Peptidase activator activity involved in apoptotic process	NAS
GO:0019911	Function	Structural constituent of myelin sheath	IBA
GO:0019911	Function	Structural constituent of myelin sheath	IDA	12153479
GO:0019911	Function	Structural constituent of myelin sheath	IEA
GO:0022010	Process	Central nervous system myelination	IEA
GO:0030154	Process	Cell differentiation	TAS	10739088
GO:0042552	Process	Myelination	IBA
GO:0042552	Process	Myelination	IEA
GO:0042552	Process	Myelination	NAS	12153479
GO:0042552	Process	Myelination	TAS	10428054
GO:0043220	Component	Schmidt-Lanterman incisure	IEA
GO:0044853	Component	Plasma membrane raft	IEA
GO:0045121	Component	Membrane raft	IDA	12153479, 23264465
GO:0045121	Component	Membrane raft	IEA
GO:0045176	Process	Apical protein localization	TAS	10739088
GO:0098737	Process	Protein insertion into plasma membrane	IEA
GO:0098737	Process	Protein insertion into plasma membrane	IMP	35217805
GO:0120003	Component	Hinge region between urothelial plaques of apical plasma membrane	IEA
GO:1902043	Process	Positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IEA

MIM	HGNC	e!Ensembl
188860	6817	ENSG00000172005

Protein

UniProt ID

P21145

Protein name

Myelin and lymphocyte protein (T-lymphocyte maturation-associated protein)

Protein function

May be involved in vesicular trafficking from the Golgi apparatus to the cell membrane. Plays a role in the maintenance of the myelin sheath, and in axon-glia and glia-glia interactions.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01284	MARVEL	18 → 145	Membrane-associating domain	Domain

Sequence

MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSV
FCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYR
HYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS

Sequence length

153

Interactions

View interactions

MAL (mal, T cell differentiation protein (MAL blood group))