Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4097
Gene name Gene Name - the full gene name approved by the HGNC.
MAF bZIP transcription factor G
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MAFG
Synonyms (NCBI Gene) Gene synonyms aliases
hMAF
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
Globin gene expression is regulated through nuclear factor erythroid-2 (NFE2) elements located in enhancer-like locus control regions positioned many kb upstream of alpha- and beta-gene clusters (summarized by Blank et al., 1997 [PubMed 9166829]). NFE2 DN
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003711 hsa-miR-218-5p qRT-PCR 19168627
MIRT003711 hsa-miR-218-5p Microarray, qRT-PCR 19168627
MIRT029000 hsa-miR-26b-5p Microarray 19088304
MIRT049582 hsa-miR-92a-3p CLASH 23622248
MIRT048503 hsa-miR-100-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II NAS 27052415, 33897412
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602020 6781 ENSG00000197063
Protein
UniProt ID O15525
Protein name Transcription factor MafG (V-maf musculoaponeurotic fibrosarcoma oncogene homolog G) (hMAF)
Protein function Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves (PubMed:11154691). However, they seem to serve as transcriptional activators by dimerizing with other (usu
PDB 7X5E , 7X5F , 7X5G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03131 bZIP_Maf 24 115 bZIP Maf transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Highly expressed in skeletal muscle. Also expressed in heart and brain.
Sequence
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLK
NRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQ
TFART
VARSPVAPARGPLAAGLGPLVPGKVAATSVITIVKSKTDARS
Sequence length 162
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Factors involved in megakaryocyte development and platelet production
<