Gene Gene information from NCBI Gene database.
Entrez ID 4097
Gene name MAF bZIP transcription factor G
Gene symbol MAFG
Synonyms (NCBI Gene)
hMAF
Chromosome 17
Chromosome location 17q25.3
Summary Globin gene expression is regulated through nuclear factor erythroid-2 (NFE2) elements located in enhancer-like locus control regions positioned many kb upstream of alpha- and beta-gene clusters (summarized by Blank et al., 1997 [PubMed 9166829]). NFE2 DN
miRNA miRNA information provided by mirtarbase database.
602
miRTarBase ID miRNA Experiments Reference
MIRT003711 hsa-miR-218-5p qRT-PCR 19168627
MIRT003711 hsa-miR-218-5p MicroarrayqRT-PCR 19168627
MIRT029000 hsa-miR-26b-5p Microarray 19088304
MIRT049582 hsa-miR-92a-3p CLASH 23622248
MIRT048503 hsa-miR-100-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II NAS 27052415, 33897412
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602020 6781 ENSG00000197063
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15525
Protein name Transcription factor MafG (V-maf musculoaponeurotic fibrosarcoma oncogene homolog G) (hMAF)
Protein function Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves (PubMed:11154691). However, they seem to serve as transcriptional activators by dimerizing with other (usu
PDB 7X5E , 7X5F , 7X5G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03131 bZIP_Maf 24 115 bZIP Maf transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Highly expressed in skeletal muscle. Also expressed in heart and brain.
Sequence
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLK
NRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQ
TFART
VARSPVAPARGPLAAGLGPLVPGKVAATSVITIVKSKTDARS
Sequence length 162
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Factors involved in megakaryocyte development and platelet production
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hereditary breast ovarian cancer syndrome Uncertain significance rs773528916 RCV001374554
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 37152370
Carcinoma Non Small Cell Lung Associate 30053382
Colorectal Neoplasms Associate 26787892
Familial Primary Pulmonary Hypertension Associate 36899621
Melanoma Associate 26787892
Neoplasms Associate 24798046, 29158814, 30053382
Non Muscle Invasive Bladder Neoplasms Associate 35787635
Pulmonary Atelectasis Associate 34089082
Squamous Cell Carcinoma of Head and Neck Associate 33618612