Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4092
Gene name	SMAD family member 7
Gene symbol	SMAD7
Synonyms (NCBI Gene)	CRCS3MADH7MADH8
Chromosome	18
Chromosome location	18q21.1
Summary	The protein encoded by this gene is a nuclear protein that binds the E3 ubiquitin ligase SMURF2. Upon binding, this complex translocates to the cytoplasm, where it interacts with TGF-beta receptor type-1 (TGFBR1), leading to the degradation of both the en

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs4939827	T>A,C	Risk-factor	Intron variant

726

Show/Hide all (726)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007153	hsa-miR-217	Luciferase reporter assay	23471579
MIRT007153	hsa-miR-217	Luciferase reporter assay	23471579
MIRT007154	hsa-miR-216a-5p	Luciferase reporter assay	23471579
MIRT007242	hsa-miR-25-3p	Luciferase reporter assay	23435373
MIRT007362	hsa-miR-21-5p	qRT-PCRWestern blot	23292313
MIRT007362	hsa-miR-21-5p	qRT-PCRWestern blot	23292313
MIRT027015	hsa-miR-103a-3p	Sequencing	20371350
MIRT027482	hsa-miR-98-5p	Microarray	19088304
MIRT028980	hsa-miR-26b-5p	Microarray	19088304
MIRT031521	hsa-miR-16-5p	Sequencing	20371350
MIRT049511	hsa-miR-92a-3p	CLASH	23622248
MIRT048391	hsa-miR-100-5p	CLASH	23622248
MIRT046499	hsa-miR-15b-5p	CLASH	23622248
MIRT053159	hsa-miR-20a-5p	Luciferase reporter assayqRT-PCRWestern blot	23665284
MIRT053873	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCRWestern blot	22286770
MIRT053874	hsa-miR-93-5p	Luciferase reporter assayqRT-PCRWestern blot	22286770
MIRT007242	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	22286770
MIRT053873	hsa-miR-106b-5p	FlowImmunofluorescenceMicroarrayqRT-PCRWestern blot	25286029
MIRT007362	hsa-miR-21-5p	ImmunocytochemistryImmunofluorescenceImmunohistochemistryLuciferase reporter assayWestern blot	24887517
MIRT046499	hsa-miR-15b-5p	Luciferase reporter assayqRT-PCRWestern blot	24435757
MIRT437832	hsa-miR-520g-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25436421
MIRT437832	hsa-miR-520g-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25436421
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT501088	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT031521	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT501087	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT501086	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT501084	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT501083	hsa-miR-595	PAR-CLIP	21572407
MIRT501082	hsa-miR-510-5p	PAR-CLIP	21572407
MIRT501081	hsa-miR-646	PAR-CLIP	21572407
MIRT501080	hsa-miR-1244	PAR-CLIP	21572407
MIRT501079	hsa-miR-3973	PAR-CLIP	21572407
MIRT501078	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT501076	hsa-miR-4459	PAR-CLIP	21572407
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	21572407
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT501072	hsa-miR-766-5p	PAR-CLIP	21572407
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	21572407
MIRT501070	hsa-miR-663b	PAR-CLIP	21572407
MIRT501069	hsa-miR-644a	PAR-CLIP	21572407
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT501065	hsa-miR-573	PAR-CLIP	21572407
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	21572407
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501082	hsa-miR-510-5p	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501082	hsa-miR-510-5p	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT501088	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT031521	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT501087	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT501086	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT501084	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT501083	hsa-miR-595	PAR-CLIP	24398324
MIRT501082	hsa-miR-510-5p	PAR-CLIP	24398324
MIRT501081	hsa-miR-646	PAR-CLIP	24398324
MIRT501080	hsa-miR-1244	PAR-CLIP	24398324
MIRT501079	hsa-miR-3973	PAR-CLIP	24398324
MIRT501078	hsa-miR-545-3p	PAR-CLIP	24398324
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	24398324
MIRT501076	hsa-miR-4459	PAR-CLIP	24398324
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	24398324
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	24398324
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	24398324
MIRT501072	hsa-miR-766-5p	PAR-CLIP	24398324
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	24398324
MIRT501070	hsa-miR-663b	PAR-CLIP	24398324
MIRT501069	hsa-miR-644a	PAR-CLIP	24398324
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	24398324
MIRT501065	hsa-miR-573	PAR-CLIP	24398324
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	24398324
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	24398324
MIRT439587	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT439586	hsa-miR-544a	HITS-CLIP	24374217
MIRT439587	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT439586	hsa-miR-544a	HITS-CLIP	24374217
MIRT049511	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT726492	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT726491	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT731249	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	26390174
MIRT731249	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	26390174
MIRT731249	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	26390174
MIRT731249	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	26390174
MIRT501086	hsa-miR-195-5p	Luciferase reporter assay	26837421
MIRT501086	hsa-miR-195-5p	Luciferase reporter assay	26837421
MIRT501088	hsa-miR-424-5p	Luciferase reporter assayqRT-PCRWestern blot	27628042
MIRT726492	hsa-miR-92b-3p	Luciferase reporter assay	27100897
MIRT726492	hsa-miR-92b-3p	Luciferase reporter assay	27100897
MIRT080118	hsa-miR-33a-3p	qRT-PCRWestern blot	25880168
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT501086	hsa-miR-195-5p	Luciferase reporter assayqRT-PCRWestern blot	27574009
MIRT007362	hsa-miR-21-5p	Luciferase reporter assayWestern blot	26575121
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT007362	hsa-miR-21-5p	Luciferase reporter assay	28192117
MIRT501087	hsa-miR-497-5p	Luciferase reporter assayqRT-PCRWestern blot	27303812
MIRT501084	hsa-miR-503-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCR	32648079
MIRT007362	hsa-miR-21-5p	Luciferase reporter assayqRT-PCR	34254453
MIRT734796	hsa-miR-21-3p	Luciferase reporter assayWestern blottingqRT-PCR	33763375
MIRT735780	hsa-miR-216a-3p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	31798627
MIRT735785	hsa-miR-107	Western blottingqRT-PCR	32606425
MIRT501084	hsa-miR-503-5p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometryELISA	33872218
MIRT053873	hsa-miR-106b-5p	Luciferase reporter assayWestern blottingqRT-PCR	31617643
MIRT734796	hsa-miR-21-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCR	31554487
MIRT736953	hsa-miR-106a-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCRIn situ hybridizationFlow cytometry	32267797
MIRT734796	hsa-miR-21-3p	Western blottingMicroarrayImmunohistochemistry (IHC)RNA-seqqRT-PCRFlow cytometry	33763375
MIRT735785	hsa-miR-107	Western blottingRNA-seqqRT-PCR	32606425
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT501088	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT031521	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT501087	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT501086	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT501084	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT501083	hsa-miR-595	PAR-CLIP	20371350
MIRT501082	hsa-miR-510-5p	PAR-CLIP	20371350
MIRT501081	hsa-miR-646	PAR-CLIP	20371350
MIRT501080	hsa-miR-1244	PAR-CLIP	20371350
MIRT501079	hsa-miR-3973	PAR-CLIP	20371350
MIRT501078	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT501076	hsa-miR-4459	PAR-CLIP	20371350
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	20371350
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	20371350
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT501072	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	20371350
MIRT501070	hsa-miR-663b	PAR-CLIP	20371350
MIRT501069	hsa-miR-644a	PAR-CLIP	20371350
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	20371350
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	20371350
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT501065	hsa-miR-573	PAR-CLIP	20371350
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	20371350
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT501088	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT031521	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT501087	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT501086	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT501084	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT501083	hsa-miR-595	PAR-CLIP	21572407
MIRT501082	hsa-miR-510-5p	PAR-CLIP	21572407
MIRT501081	hsa-miR-646	PAR-CLIP	21572407
MIRT501080	hsa-miR-1244	PAR-CLIP	21572407
MIRT501079	hsa-miR-3973	PAR-CLIP	21572407
MIRT501078	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT501076	hsa-miR-4459	PAR-CLIP	21572407
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	21572407
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT501072	hsa-miR-766-5p	PAR-CLIP	21572407
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	21572407
MIRT501070	hsa-miR-663b	PAR-CLIP	21572407
MIRT501069	hsa-miR-644a	PAR-CLIP	21572407
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT501065	hsa-miR-573	PAR-CLIP	21572407
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	21572407
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501082	hsa-miR-510-5p	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT501088	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT031521	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT501087	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT501086	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT501084	hsa-miR-503-5p	PAR-CLIP	23446348
MIRT501083	hsa-miR-595	PAR-CLIP	23446348
MIRT501082	hsa-miR-510-5p	PAR-CLIP	23446348
MIRT501081	hsa-miR-646	PAR-CLIP	23446348
MIRT501080	hsa-miR-1244	PAR-CLIP	23446348
MIRT501079	hsa-miR-3973	PAR-CLIP	23446348
MIRT501078	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT501076	hsa-miR-4459	PAR-CLIP	23446348
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	23446348
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	23446348
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	23446348
MIRT501072	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	23446348
MIRT501070	hsa-miR-663b	PAR-CLIP	23446348
MIRT501069	hsa-miR-644a	PAR-CLIP	23446348
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	23446348
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	23446348
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT501065	hsa-miR-573	PAR-CLIP	23446348
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	23446348
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	23446348
MIRT501089	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT501088	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT031521	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT501087	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT046499	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT501086	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT501085	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT501084	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT501083	hsa-miR-595	PAR-CLIP	24398324
MIRT501082	hsa-miR-510-5p	PAR-CLIP	24398324
MIRT501081	hsa-miR-646	PAR-CLIP	24398324
MIRT501080	hsa-miR-1244	PAR-CLIP	24398324
MIRT501079	hsa-miR-3973	PAR-CLIP	24398324
MIRT501078	hsa-miR-545-3p	PAR-CLIP	24398324
MIRT501077	hsa-miR-4768-3p	PAR-CLIP	24398324
MIRT501076	hsa-miR-4459	PAR-CLIP	24398324
MIRT501075	hsa-miR-4433a-3p	PAR-CLIP	24398324
MIRT501074	hsa-miR-3664-3p	PAR-CLIP	24398324
MIRT501073	hsa-miR-4795-5p	PAR-CLIP	24398324
MIRT501072	hsa-miR-766-5p	PAR-CLIP	24398324
MIRT501071	hsa-miR-6735-3p	PAR-CLIP	24398324
MIRT501070	hsa-miR-663b	PAR-CLIP	24398324
MIRT501069	hsa-miR-644a	PAR-CLIP	24398324
MIRT501068	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT501067	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT501066	hsa-miR-3616-5p	PAR-CLIP	24398324
MIRT501065	hsa-miR-573	PAR-CLIP	24398324
MIRT501064	hsa-miR-7108-5p	PAR-CLIP	24398324
MIRT501063	hsa-miR-374b-3p	PAR-CLIP	24398324
MIRT1371091	hsa-miR-15a	CLIP-seq
MIRT1371092	hsa-miR-15b	CLIP-seq
MIRT1371093	hsa-miR-16	CLIP-seq
MIRT1371094	hsa-miR-195	CLIP-seq
MIRT1371095	hsa-miR-25	CLIP-seq
MIRT1371096	hsa-miR-32	CLIP-seq
MIRT1371097	hsa-miR-363	CLIP-seq
MIRT1371098	hsa-miR-3647-5p	CLIP-seq
MIRT1371099	hsa-miR-367	CLIP-seq
MIRT1371100	hsa-miR-424	CLIP-seq
MIRT1371101	hsa-miR-4433	CLIP-seq
MIRT1371102	hsa-miR-4524	CLIP-seq
MIRT1371103	hsa-miR-4643	CLIP-seq
MIRT1371104	hsa-miR-466	CLIP-seq
MIRT1371105	hsa-miR-4789-3p	CLIP-seq
MIRT1371106	hsa-miR-4789-5p	CLIP-seq
MIRT1371107	hsa-miR-497	CLIP-seq
MIRT1371108	hsa-miR-503	CLIP-seq
MIRT1371109	hsa-miR-510	CLIP-seq
MIRT1371110	hsa-miR-545	CLIP-seq
MIRT1371111	hsa-miR-578	CLIP-seq
MIRT1371112	hsa-miR-92a	CLIP-seq
MIRT1371113	hsa-miR-92b	CLIP-seq
MIRT1371114	hsa-miR-1206	CLIP-seq
MIRT1371115	hsa-miR-1207-5p	CLIP-seq
MIRT1371116	hsa-miR-1266	CLIP-seq
MIRT1371117	hsa-miR-1322	CLIP-seq
MIRT1371118	hsa-miR-181a	CLIP-seq
MIRT1371119	hsa-miR-181b	CLIP-seq
MIRT1371120	hsa-miR-181c	CLIP-seq
MIRT1371121	hsa-miR-181d	CLIP-seq
MIRT1371122	hsa-miR-1909	CLIP-seq
MIRT1371095	hsa-miR-25	CLIP-seq
MIRT1371123	hsa-miR-3131	CLIP-seq
MIRT1371124	hsa-miR-3163	CLIP-seq
MIRT1371096	hsa-miR-32	CLIP-seq
MIRT1371125	hsa-miR-330-3p	CLIP-seq
MIRT1371126	hsa-miR-340	CLIP-seq
MIRT1371127	hsa-miR-3591-3p	CLIP-seq
MIRT1371128	hsa-miR-3613-3p	CLIP-seq
MIRT1371097	hsa-miR-363	CLIP-seq
MIRT1371099	hsa-miR-367	CLIP-seq
MIRT1371129	hsa-miR-371-5p	CLIP-seq
MIRT1371130	hsa-miR-371b-5p	CLIP-seq
MIRT1371131	hsa-miR-3926	CLIP-seq
MIRT1371132	hsa-miR-4262	CLIP-seq
MIRT1371133	hsa-miR-4270	CLIP-seq
MIRT1371134	hsa-miR-4441	CLIP-seq
MIRT1371135	hsa-miR-4468	CLIP-seq
MIRT1371136	hsa-miR-4518	CLIP-seq
MIRT1371103	hsa-miR-4643	CLIP-seq
MIRT1371104	hsa-miR-466	CLIP-seq
MIRT1371137	hsa-miR-4683	CLIP-seq
MIRT1371138	hsa-miR-4736	CLIP-seq
MIRT1371139	hsa-miR-4753-3p	CLIP-seq
MIRT1371140	hsa-miR-4763-3p	CLIP-seq
MIRT1371141	hsa-miR-4768-5p	CLIP-seq
MIRT1371105	hsa-miR-4789-3p	CLIP-seq
MIRT1371106	hsa-miR-4789-5p	CLIP-seq
MIRT1371142	hsa-miR-513a-3p	CLIP-seq
MIRT1371143	hsa-miR-548ad	CLIP-seq
MIRT1371144	hsa-miR-548s	CLIP-seq
MIRT1371111	hsa-miR-578	CLIP-seq
MIRT1371145	hsa-miR-580	CLIP-seq
MIRT1371146	hsa-miR-611	CLIP-seq
MIRT1371147	hsa-miR-665	CLIP-seq
MIRT1371112	hsa-miR-92a	CLIP-seq
MIRT1371113	hsa-miR-92b	CLIP-seq
MIRT1371148	hsa-miR-942	CLIP-seq
MIRT1371115	hsa-miR-1207-5p	CLIP-seq
MIRT1371149	hsa-miR-1226	CLIP-seq
MIRT1371122	hsa-miR-1909	CLIP-seq
MIRT1371150	hsa-miR-2964a-5p	CLIP-seq
MIRT1371151	hsa-miR-3144-5p	CLIP-seq
MIRT1371152	hsa-miR-3148	CLIP-seq
MIRT1371153	hsa-miR-3160-3p	CLIP-seq
MIRT1371124	hsa-miR-3163	CLIP-seq
MIRT1371154	hsa-miR-3175	CLIP-seq
MIRT1371155	hsa-miR-3183	CLIP-seq
MIRT1371156	hsa-miR-3184	CLIP-seq
MIRT1371157	hsa-miR-3191	CLIP-seq
MIRT1371126	hsa-miR-340	CLIP-seq
MIRT1371158	hsa-miR-342-3p	CLIP-seq
MIRT1371159	hsa-miR-3616-3p	CLIP-seq
MIRT1371160	hsa-miR-377	CLIP-seq
MIRT1371161	hsa-miR-3929	CLIP-seq
MIRT1371162	hsa-miR-423-5p	CLIP-seq
MIRT1371163	hsa-miR-4263	CLIP-seq
MIRT1371164	hsa-miR-4419b	CLIP-seq
MIRT1371165	hsa-miR-4436b-3p	CLIP-seq
MIRT1371166	hsa-miR-4478	CLIP-seq
MIRT1371167	hsa-miR-4487	CLIP-seq
MIRT1371168	hsa-miR-4497	CLIP-seq
MIRT1371169	hsa-miR-4514	CLIP-seq
MIRT1371170	hsa-miR-4652-5p	CLIP-seq
MIRT1371171	hsa-miR-4667-5p	CLIP-seq
MIRT1371172	hsa-miR-4668-5p	CLIP-seq
MIRT1371173	hsa-miR-4685-5p	CLIP-seq
MIRT1371174	hsa-miR-4692	CLIP-seq
MIRT1371175	hsa-miR-4699-3p	CLIP-seq
MIRT1371176	hsa-miR-4700-5p	CLIP-seq
MIRT1371177	hsa-miR-4723-3p	CLIP-seq
MIRT1371178	hsa-miR-4731-5p	CLIP-seq
MIRT1371179	hsa-miR-4733-3p	CLIP-seq
MIRT1371140	hsa-miR-4763-3p	CLIP-seq
MIRT1371180	hsa-miR-4803	CLIP-seq
MIRT1371181	hsa-miR-483-3p	CLIP-seq
MIRT1371182	hsa-miR-485-5p	CLIP-seq
MIRT1371183	hsa-miR-548ac	CLIP-seq
MIRT1371143	hsa-miR-548ad	CLIP-seq
MIRT1371184	hsa-miR-548d-3p	CLIP-seq
MIRT1371185	hsa-miR-548z	CLIP-seq
MIRT1371186	hsa-miR-558	CLIP-seq
MIRT1371187	hsa-miR-576-5p	CLIP-seq
MIRT1371188	hsa-miR-603	CLIP-seq
MIRT1371189	hsa-miR-940	CLIP-seq
MIRT1371129	hsa-miR-371-5p	CLIP-seq
MIRT1371130	hsa-miR-371b-5p	CLIP-seq
MIRT1371169	hsa-miR-4514	CLIP-seq
MIRT1371174	hsa-miR-4692	CLIP-seq
MIRT2110145	hsa-miR-1288	CLIP-seq
MIRT2110146	hsa-miR-3199	CLIP-seq
MIRT2110147	hsa-miR-1262	CLIP-seq
MIRT2110148	hsa-miR-4701-3p	CLIP-seq
MIRT1371115	hsa-miR-1207-5p	CLIP-seq
MIRT1371149	hsa-miR-1226	CLIP-seq
MIRT2110147	hsa-miR-1262	CLIP-seq
MIRT2333675	hsa-miR-1263	CLIP-seq
MIRT1371116	hsa-miR-1266	CLIP-seq
MIRT1371091	hsa-miR-15a	CLIP-seq
MIRT1371092	hsa-miR-15b	CLIP-seq
MIRT1371093	hsa-miR-16	CLIP-seq
MIRT1371118	hsa-miR-181a	CLIP-seq
MIRT1371119	hsa-miR-181b	CLIP-seq
MIRT1371120	hsa-miR-181c	CLIP-seq
MIRT1371121	hsa-miR-181d	CLIP-seq
MIRT1371122	hsa-miR-1909	CLIP-seq
MIRT1371094	hsa-miR-195	CLIP-seq
MIRT2333676	hsa-miR-200b	CLIP-seq
MIRT2333677	hsa-miR-200c	CLIP-seq
MIRT2333678	hsa-miR-2392	CLIP-seq
MIRT2333679	hsa-miR-2682	CLIP-seq
MIRT1371150	hsa-miR-2964a-5p	CLIP-seq
MIRT1371153	hsa-miR-3160-3p	CLIP-seq
MIRT1371154	hsa-miR-3175	CLIP-seq
MIRT1371156	hsa-miR-3184	CLIP-seq
MIRT2333680	hsa-miR-3189-3p	CLIP-seq
MIRT2333681	hsa-miR-3200-3p	CLIP-seq
MIRT2333682	hsa-miR-33a	CLIP-seq
MIRT2333683	hsa-miR-33b	CLIP-seq
MIRT2333684	hsa-miR-34a	CLIP-seq
MIRT2333685	hsa-miR-34c-5p	CLIP-seq
MIRT1371159	hsa-miR-3616-3p	CLIP-seq
MIRT2333686	hsa-miR-3646	CLIP-seq
MIRT1371161	hsa-miR-3929	CLIP-seq
MIRT2333687	hsa-miR-3940-5p	CLIP-seq
MIRT2333688	hsa-miR-3942-5p	CLIP-seq
MIRT1371162	hsa-miR-423-5p	CLIP-seq
MIRT1371100	hsa-miR-424	CLIP-seq
MIRT1371132	hsa-miR-4262	CLIP-seq
MIRT1371163	hsa-miR-4263	CLIP-seq
MIRT1371133	hsa-miR-4270	CLIP-seq
MIRT2333689	hsa-miR-429	CLIP-seq
MIRT2333690	hsa-miR-4300	CLIP-seq
MIRT2333691	hsa-miR-4318	CLIP-seq
MIRT1371164	hsa-miR-4419b	CLIP-seq
MIRT1371101	hsa-miR-4433	CLIP-seq
MIRT1371165	hsa-miR-4436b-3p	CLIP-seq
MIRT1371134	hsa-miR-4441	CLIP-seq
MIRT1371166	hsa-miR-4478	CLIP-seq
MIRT1371167	hsa-miR-4487	CLIP-seq
MIRT2333692	hsa-miR-449a	CLIP-seq
MIRT2333693	hsa-miR-449b	CLIP-seq
MIRT2333694	hsa-miR-449c	CLIP-seq
MIRT2333695	hsa-miR-4507	CLIP-seq
MIRT1371169	hsa-miR-4514	CLIP-seq
MIRT1371136	hsa-miR-4518	CLIP-seq
MIRT1371102	hsa-miR-4524	CLIP-seq
MIRT2333696	hsa-miR-4663	CLIP-seq
MIRT1371137	hsa-miR-4683	CLIP-seq
MIRT1371173	hsa-miR-4685-5p	CLIP-seq
MIRT2333697	hsa-miR-4690-5p	CLIP-seq
MIRT1371174	hsa-miR-4692	CLIP-seq
MIRT2333698	hsa-miR-4693-5p	CLIP-seq
MIRT2110148	hsa-miR-4701-3p	CLIP-seq
MIRT2333699	hsa-miR-4703-5p	CLIP-seq
MIRT2333700	hsa-miR-4729	CLIP-seq
MIRT1371179	hsa-miR-4733-3p	CLIP-seq
MIRT2333701	hsa-miR-4757-3p	CLIP-seq
MIRT1371140	hsa-miR-4763-3p	CLIP-seq
MIRT2333702	hsa-miR-4792	CLIP-seq
MIRT1371182	hsa-miR-485-5p	CLIP-seq
MIRT1371107	hsa-miR-497	CLIP-seq
MIRT1371108	hsa-miR-503	CLIP-seq
MIRT1371109	hsa-miR-510	CLIP-seq
MIRT2333703	hsa-miR-512-3p	CLIP-seq
MIRT2333704	hsa-miR-543	CLIP-seq
MIRT1371110	hsa-miR-545	CLIP-seq
MIRT1371186	hsa-miR-558	CLIP-seq
MIRT1371187	hsa-miR-576-5p	CLIP-seq
MIRT1371147	hsa-miR-665	CLIP-seq
MIRT2333705	hsa-miR-892a	CLIP-seq
MIRT2333706	hsa-miR-920	CLIP-seq
MIRT1371189	hsa-miR-940	CLIP-seq
MIRT2333707	hsa-miR-500a	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
FOS	Activation	15579469
HDAC1	Unknown	24369345
JUN	Activation	15579469
MTA1	Repression	22841502
SKIL	Repression	23154975
SMAD3	Repression	12761881
SMAD3	Unknown	10559222;10823886
SMAD4	Unknown	10559222;10823886
YY1	Unknown	24369345

Show/Hide all (97)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17438144
GO:0000785	Component	Chromatin	ISA
GO:0001650	Component	Fibrillar center	IDA
GO:0001657	Process	Ureteric bud development	IEA
GO:0002725	Process	Negative regulation of T cell cytokine production	IEA
GO:0002725	Process	Negative regulation of T cell cytokine production	ISS
GO:0003714	Function	Transcription corepressor activity	IDA	17438144
GO:0005515	Function	Protein binding	IPI	14993265, 15231748, 16601693, 16720724, 18593713, 18762808, 20937913, 21258410, 21791611, 22344298, 22921829, 25283809
GO:0005518	Function	Collagen binding	IEA
GO:0005634	Component	Nucleus	IDA	11278251, 12151385, 17438144
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IDA	11278251, 12151385, 17438144
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	12151385
GO:0005912	Component	Adherens junction	IDA	18593713
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	18593713
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0008013	Function	Beta-catenin binding	IPI	18593713
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0010717	Process	Regulation of epithelial to mesenchymal transition	IMP	24887517
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	TAS	19018011
GO:0010944	Process	Negative regulation of transcription by competitive promoter binding	IDA	17438144
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030336	Process	Negative regulation of cell migration	TAS	19018011
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IDA	9256479, 11278251, 12151385, 17438144, 18762808
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IMP	16601693, 21791611
GO:0030514	Process	Negative regulation of BMP signaling pathway	IDA	17438144
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0031503	Process	Protein-containing complex localization	IDA	18593713
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11278251, 12151385, 16720724
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	TAS	11278251
GO:0032926	Process	Negative regulation of activin receptor signaling pathway	IDA	16720724
GO:0032926	Process	Negative regulation of activin receptor signaling pathway	IEA
GO:0032984	Process	Protein-containing complex disassembly	IDA	18593713
GO:0032991	Component	Protein-containing complex	IDA	23610558
GO:0032991	Component	Protein-containing complex	IEA
GO:0034333	Process	Adherens junction assembly	IMP	18593713
GO:0034616	Process	Response to laminar fluid shear stress	IEA
GO:0034616	Process	Response to laminar fluid shear stress	IEP	9256479
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IEA
GO:0034713	Function	Type I transforming growth factor beta receptor binding	IPI	11278251
GO:0036064	Component	Ciliary basal body	IDA
GO:0036064	Component	Ciliary basal body	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048844	Process	Artery morphogenesis	IEA
GO:0048844	Process	Artery morphogenesis	ISS
GO:0050821	Process	Protein stabilization	IDA	18593713
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	IEA
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	ISS
GO:0055117	Process	Regulation of cardiac muscle contraction	IEA
GO:0055117	Process	Regulation of cardiac muscle contraction	ISS
GO:0060373	Process	Regulation of ventricular cardiac muscle cell membrane depolarization	IEA
GO:0060373	Process	Regulation of ventricular cardiac muscle cell membrane depolarization	ISS	18952608
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IDA	17438144
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IMP	16601693
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	ISS
GO:0060395	Process	SMAD protein signal transduction	IBA
GO:0060395	Process	SMAD protein signal transduction	IDA	18593713
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0070411	Function	I-SMAD binding	IBA
GO:0070411	Function	I-SMAD binding	IEA
GO:0070411	Function	I-SMAD binding	IPI	9256479
GO:0070697	Function	Activin receptor binding	IEA
GO:0070697	Function	Activin receptor binding	IPI	16720724
GO:0071144	Component	Heteromeric SMAD protein complex	IBA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0140416	Function	Transcription regulator inhibitor activity	IBA
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	9256479
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:0141091	Process	Transforming growth factor beta receptor superfamily signaling pathway	IEA
GO:1902731	Process	Negative regulation of chondrocyte proliferation	IEA
GO:1903043	Process	Positive regulation of chondrocyte hypertrophy	IEA
GO:1904886	Process	Beta-catenin destruction complex disassembly	IDA	18593713
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	11278251
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IDA	18593713
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IEA
GO:2000317	Process	Negative regulation of T-helper 17 type immune response	IEA
GO:2000317	Process	Negative regulation of T-helper 17 type immune response	ISS
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	IEA
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	ISS

MIM	HGNC	e!Ensembl
602932	6773	ENSG00000101665

O15105

Protein name

Mothers against decapentaplegic homolog 7 (MAD homolog 7) (Mothers against DPP homolog 7) (Mothers against decapentaplegic homolog 8) (MAD homolog 8) (Mothers against DPP homolog 8) (SMAD family member 7) (SMAD 7) (Smad7) (hSMAD7)

Protein function

Antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2

PDB

2DJY , 2KXQ , 2LTV , 2LTW , 2LTX , 2LTY , 2LTZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03165	MH1	92 → 202	MH1 domain	Domain
PF03166	MH2	259 → 424	MH2 domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous with higher expression in the lung and vascular endothelium.

Sequence

MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGC
CLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG
TRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC
ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNY
LAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQ
LNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKV
FPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLE
VIFNSR

Sequence length

426

Interactions

View interactions

	KEGG		Reactome
	TGF-beta signaling pathway Hippo signaling pathway		Signaling by BMP Downregulation of TGF-beta receptor signaling SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription Ub-specific processing proteases

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Colorectal cancer, susceptibility to, 3	risk factor; Uncertain significance	rs4939827, rs778935609	RCV000007117 RCV003225778
Hereditary breast ovarian cancer syndrome	Uncertain significance	rs773511006	RCV001374531
SMAD7-related disorder	Likely benign; Benign	rs369794757, rs3764482, rs939657757, rs3736242, rs763219099, rs536465216, rs1180015903, rs145686330	RCV003981504 RCV003974443 RCV003906875 RCV003977307 RCV003911526 RCV003931508 RCV003946940 RCV003955904

Show/Hide Text Mining Associations (130)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	25554686
Adenocarcinoma of Lung	Associate	33628780
Adenoma	Associate	21102417, 22999960
Altitude Sickness	Associate	35875936
Alzheimer Disease	Associate	35366391
Anodontia	Associate	37833774
Arthritis Rheumatoid	Associate	20628268
Atherosclerosis	Associate	33282009
Autoimmune Diseases	Associate	31968593
Bile Duct Diseases	Stimulate	19878580
Breast Neoplasms	Associate	12947087, 23372687, 24090133, 27188720, 29893810, 30545440, 32856881, 34370213, 39337574
Breast Neoplasms	Stimulate	30594253
Calcinosis Cutis	Associate	27662660
Carcinogenesis	Associate	12947087, 24343358, 24969865, 29084532, 30229897, 31264769
Carcinogenesis	Inhibit	32096163
Carcinoma Hepatocellular	Associate	16489684, 23991075, 25436421, 26989026, 28192402, 31264769
Carcinoma Non Small Cell Lung	Associate	27185036, 32141555, 37851987
Carcinoma Non Small Cell Lung	Inhibit	32150102
Carcinoma Pancreatic Ductal	Associate	21768661
Carcinoma Squamous Cell	Associate	37746966
Cardiomyopathy Hypertrophic	Associate	36878974
Carotid Stenosis	Associate	33282009
Chemical and Drug Induced Liver Injury	Associate	27990439
Cholangiocarcinoma	Associate	23244128
Colonic Diseases	Associate	24969865
Colonic Neoplasms	Associate	19155440
Colorectal Neoplasms	Associate	18372901, 19155440, 19357349, 20124488, 20501757, 20648012, 21071539, 21119214, 21179028, 21910156, 22367214, 22457859, 22505654, 22580541, 22879968 View all (32 more)
Colorectal Neoplasms	Inhibit	29297384
Constriction Pathologic	Associate	18756605
Crohn Disease	Associate	11518734, 31968593, 33076905, 33871807, 35263186, 35841457
Cyclic neutropenia	Associate	21189329
Dermatitis Atopic	Associate	23436698
Diabetes Mellitus Type 1	Associate	23637351
Disease	Associate	26989026
Disease	Stimulate	27861825
Drug Resistant Epilepsy	Stimulate	27861825
Duane Retraction Syndrome	Associate	24047375
Duodenal Ulcer	Inhibit	21445336
Esophageal Neoplasms	Associate	25554686, 26078566
Esophageal Neoplasms	Inhibit	34725559
Esophageal Squamous Cell Carcinoma	Associate	15736400, 27619676, 30611100, 36056599
Fibrosis	Associate	19878580, 30983140
Ganglioneuromatosis of the Alimentary Tract	Associate	25554686
Glaucoma Open Angle	Associate	19450457, 22876112
Glioblastoma	Inhibit	28735518
Glomerulonephritis IGA	Associate	19693466
Head and Neck Neoplasms	Associate	22641218
Heart Defects Congenital	Associate	24039762
Heart Failure	Associate	36878974
Hyperandrogenism	Inhibit	29116087
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	28465657
Hypoxia	Associate	35346905, 35875936
Idiopathic Pulmonary Fibrosis	Associate	37416778
Immunoglobulin G4 Related Disease	Associate	12974945
Infections	Associate	27693511
Inflammation	Associate	10839991, 11518734, 14600158, 21910156, 27861825, 31522440, 33076905, 33282009, 35841457
Inflammatory Bowel Diseases	Associate	11518734, 14600158, 20944558, 32397546
Intracranial Arteriovenous Malformations	Stimulate	36198763
Juvenile polyposis syndrome	Associate	25554686
Keratoconus	Associate	26015770, 36160033
Kidney Failure Chronic	Associate	22505654
Leukemia Erythroblastic Acute	Associate	18041647
Leukemia Lymphocytic Chronic B Cell	Associate	28349818
Leukemia Lymphoma Adult T Cell	Associate	35449091
Leukemia Myeloid Acute	Associate	33780363
Lichen Planus Oral	Associate	14675171
Light Fixation Seizure Syndrome	Inhibit	32973329
Liver Cirrhosis	Associate	31148365
Lung Diseases Interstitial	Associate	31085559
Lung Neoplasms	Associate	21569311, 34254453
Lymphatic Metastasis	Associate	15033661, 23244128
Lymphatic Metastasis	Inhibit	30611100
Melanoma	Associate	20738806
Mood Disorders	Associate	33828235
Mucocutaneous Lymph Node Syndrome	Associate	30078021
Multiple Sclerosis	Associate	21093933, 31968593
Myelodysplastic Syndromes	Inhibit	21189329
Myelodysplastic Syndromes	Associate	30015844
Myocardial Infarction	Associate	35346905
Myocardial Infarction	Inhibit	37713818
N syndrome	Associate	32973329
Nasal Polyps	Associate	37382248
Nasopharyngeal Carcinoma	Associate	26390174
Necrosis	Stimulate	24343358
Neoplasm Invasiveness	Associate	24752577
Neoplasm Metastasis	Associate	21910156, 24345480, 25436421, 27662660, 30320389, 31264769, 35982887
Neoplasm Metastasis	Stimulate	24752577
Neoplasm Metastasis	Inhibit	32096163
Neoplasms	Associate	12947087, 15033661, 21569311, 21768661, 23104301, 24090133, 24659668, 24752577, 24969865, 26390174, 26779637, 26982322, 27185036, 27473228, 29084532 View all (4 more)
Neoplasms	Inhibit	21910156, 24004452, 30611100
Neoplasms Multiple Primary	Associate	21102417
Netherton Syndrome	Stimulate	19693466
Neuroblastoma	Associate	24345480
Nonsyndromic Holoprosencephaly	Associate	25060766
O'Donnell Pappas syndrome	Associate	38634365
Obesity	Associate	32108968
Osteonecrosis	Associate	25060766
Osteoporosis	Associate	30338786
Osteoradionecrosis	Associate	21726429
Osteosarcoma	Associate	31251735
Ovarian Neoplasms	Associate	24394555
Pancreatitis	Associate	27473228
Paraparesis Tropical Spastic	Inhibit	18326816
Pelvic Organ Prolapse	Associate	29737911
Penile Induration	Associate	25532569
Persistent Infection	Associate	31522440
Pituitary Neoplasms	Associate	24636138
Prostatic Neoplasms	Associate	15708859, 29278879
Prostatitis	Associate	10801443
Pulmonary Disease Chronic Obstructive	Associate	16707515, 19087346, 36217332
Pulmonary Fibrosis	Associate	25487928, 31085559
Purpura Thrombocytopenic Idiopathic	Associate	29327472
Rectal Diseases	Associate	18372901
Rectal Neoplasms	Associate	22457859, 26779637, 29119627, 38146644
Renal Tubular Transport Inborn Errors	Associate	19693466
Sinusitis	Associate	37382248
Smooth Muscle Tumor	Associate	17468136
Spondylitis Ankylosing	Associate	38634365
Squamous Cell Carcinoma of Head and Neck	Associate	20462450
Squamous Cell Carcinoma of Head and Neck	Inhibit	26982322
Status Asthmaticus	Associate	34257337
Stomach Neoplasms	Associate	15033661, 15609398, 24659668, 24752577, 35449150
Stomach Neoplasms	Inhibit	32096163
Thyroid Carcinoma Anaplastic	Stimulate	24126800
Thyroid Carcinoma Anaplastic	Associate	31243343
Thyroid Neoplasms	Associate	24126800
Triple Negative Breast Neoplasms	Associate	28674186
Urinary Bladder Neoplasms	Associate	35982887
Uterine Cervical Neoplasms	Associate	35791307
Varicose Ulcer	Associate	20069132

SMAD7 (SMAD family member 7)