Gene Gene information from NCBI Gene database.
Entrez ID 4091
Gene name SMAD family member 6
Gene symbol SMAD6
Synonyms (NCBI Gene)
AOVD2HsT17432MADH6MADH7
Chromosome 15
Chromosome location 15q22.31
Summary The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila `mothers against decapentaplegic` (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple
SNPs SNP information provided by dbSNP.
25
SNP ID Visualize variation Clinical significance Consequence
rs387907283 G>A,T Uncertain-significance, pathogenic Coding sequence variant, genic downstream transcript variant, non coding transcript variant, missense variant
rs387907284 C>G,T Pathogenic Coding sequence variant, genic downstream transcript variant, non coding transcript variant, missense variant
rs761888345 C>T Risk-factor Missense variant, genic downstream transcript variant, non coding transcript variant, coding sequence variant
rs768542939 G>A,C Pathogenic Missense variant, upstream transcript variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant
rs900988907 C>A,G Pathogenic Genic downstream transcript variant, coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
156
miRTarBase ID miRNA Experiments Reference
MIRT001951 hsa-miR-520h Luciferase reporter assay 18189265
MIRT001951 hsa-miR-520h Microarray;Other 18189265
MIRT030225 hsa-miR-26b-5p Microarray 19088304
MIRT627567 hsa-miR-8066 HITS-CLIP 23824327
MIRT627566 hsa-miR-4501 HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
CREB1 Activation 14755548
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
84
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 16491121
GO:0001657 Process Ureteric bud development IEA
GO:0003148 Process Outflow tract septum morphogenesis IEA
GO:0003148 Process Outflow tract septum morphogenesis ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602931 6772 ENSG00000137834
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43541
Protein name Mothers against decapentaplegic homolog 6 (MAD homolog 6) (Mothers against DPP homolog 6) (SMAD family member 6) (SMAD 6) (Smad6) (hSMAD6)
Protein function Transforming growth factor-beta superfamily receptors signaling occurs through the Smad family of intracellular mediators. SMAD6 is an inhibitory Smad (i-Smad) that negatively regulates signaling downstream of type I transforming growth factor-b
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03165 MH1 172 270 MH1 domain Domain
PF03166 MH2 329 493 MH2 domain Family
Tissue specificity TISSUE SPECIFICITY: [Isoform B]: Expressed in the brain, heart, ovary, peripheral blood leukocytes, small intestine, spleen, thymus, bone marrow, fetal liver and lymph nodes. {ECO:0000269|PubMed:11284962}.
Sequence
MFRSKRSGLVRRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAREGGGCGRSEV
RPVAPRRPRDAVGQRGAQGAGRRRRAGGPPRPMSEPGAGAGSSLLDVAEPGGPGWLPESD
CETVTCCLFSERDAAGAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLL
KRLKERSLDTLLEAVESRGGVPGGCVLVPRADLRLGGQPAPPQLLLGRLFRWPDLQHAVE
LKPLCGCHSFAAAADGPTVCCNPYHFSRLC
GPESPPPPYSRLSPRDEYKPLDLSDSTLSY
TETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDL
PQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAP
GGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKGWGPCYSRQF
ITSCPCWLEILLN
NPR
Sequence length 496
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  TGF-beta signaling pathway   Signaling by BMP
RUNX2 regulates bone development
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
838
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Abnormal axial skeleton morphology Pathogenic; Likely pathogenic rs755868380, rs2140581013 RCV001799808
RCV001799787
Aortic valve disease 1 Pathogenic; Likely pathogenic rs1567092020, rs900988907 RCV000770958
RCV000770957
Aortic valve disease 2 Likely pathogenic; Pathogenic rs2140581013, rs1424182433, rs2140596481, rs2541900116, rs1567092048, rs1325349483, rs387907283, rs1595804976 RCV005005252
RCV005051916
RCV001783779
RCV003985972
RCV004555162
RCV004555360
RCV000030753
RCV000787047
Craniosynostosis 7 Likely pathogenic; Pathogenic rs2140581013, rs868327024, rs1893041298 RCV005005252
RCV003151401
RCV001283760
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Aneurysm-osteoarthritis syndrome Conflicting classifications of pathogenicity rs1246889300 RCV000538622
Bicuspid aortic valve Uncertain significance rs1473812330 RCV001799794
CRANIOSYNOSTOSIS 7, SUSCEPTIBILITY TO risk factor; Conflicting classifications of pathogenicity; Uncertain significance rs1085307122, rs1064793003, rs761888345 RCV000477938
RCV000477817
RCV000477904
Craniosynostosis syndrome Conflicting classifications of pathogenicity rs958818801 RCV001849446
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 26683690
Adenocarcinoma of Lung Associate 31503425
Aortic Aneurysm Thoracic Associate 30796334
Arteriovenous Malformations Inhibit 36198763
Autism Spectrum Disorder Associate 34948243
Autistic Disorder Associate 34208845
Axial osteomalacia Associate 34953066
Bicuspid Aortic Valve Disease Associate 30796334, 32748548
Bone Diseases Associate 29420098
Calcinosis Cutis Associate 27662660