Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	409
Gene name	Arrestin beta 2
Gene symbol	ARRB2
Synonyms (NCBI Gene)	ARB2ARR2BARR2
Chromosome	17
Chromosome location	17p13.2
Summary	Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory si

118

Show/Hide all (118)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045486	hsa-miR-149-5p	CLASH	23622248
MIRT039876	hsa-miR-615-3p	CLASH	23622248
MIRT038258	hsa-miR-330-5p	CLASH	23622248
MIRT481458	hsa-miR-9500	PAR-CLIP	23592263
MIRT481457	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT481456	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT481455	hsa-miR-7515	PAR-CLIP	23592263
MIRT481454	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT481453	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT481452	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT481451	hsa-miR-5194	PAR-CLIP	23592263
MIRT481450	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT481449	hsa-miR-2115-5p	PAR-CLIP	23592263
MIRT481448	hsa-miR-6077	PAR-CLIP	23592263
MIRT481447	hsa-miR-3202	PAR-CLIP	23592263
MIRT481445	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT481446	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT481444	hsa-miR-4271	PAR-CLIP	23592263
MIRT481443	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT481442	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT481441	hsa-miR-4710	PAR-CLIP	23592263
MIRT481440	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT116603	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT728304	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT728303	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT728302	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT728300	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT481458	hsa-miR-9500	PAR-CLIP	23592263
MIRT481457	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT481456	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT481455	hsa-miR-7515	PAR-CLIP	23592263
MIRT481454	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT481453	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT481452	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT481451	hsa-miR-5194	PAR-CLIP	23592263
MIRT481450	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT481449	hsa-miR-2115-5p	PAR-CLIP	23592263
MIRT481448	hsa-miR-6077	PAR-CLIP	23592263
MIRT481447	hsa-miR-3202	PAR-CLIP	23592263
MIRT481445	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT481446	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT481444	hsa-miR-4271	PAR-CLIP	23592263
MIRT481443	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT481442	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT481441	hsa-miR-4710	PAR-CLIP	23592263
MIRT481440	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT116603	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT755378	hsa-miR-365a-3p	Luciferase reporter assayWestern blottingqRT-PCR	35958620
MIRT800609	hsa-miR-3184	CLIP-seq
MIRT800610	hsa-miR-4492	CLIP-seq
MIRT800611	hsa-miR-4498	CLIP-seq
MIRT800612	hsa-miR-4505	CLIP-seq
MIRT800613	hsa-miR-762	CLIP-seq
MIRT800614	hsa-miR-1208	CLIP-seq
MIRT800615	hsa-miR-155	CLIP-seq
MIRT800616	hsa-miR-181a	CLIP-seq
MIRT800617	hsa-miR-181b	CLIP-seq
MIRT800618	hsa-miR-181c	CLIP-seq
MIRT800619	hsa-miR-181d	CLIP-seq
MIRT800620	hsa-miR-1908	CLIP-seq
MIRT800621	hsa-miR-3127-3p	CLIP-seq
MIRT800622	hsa-miR-3135b	CLIP-seq
MIRT800623	hsa-miR-3180-5p	CLIP-seq
MIRT800624	hsa-miR-3613-3p	CLIP-seq
MIRT800625	hsa-miR-3647-3p	CLIP-seq
MIRT800626	hsa-miR-365	CLIP-seq
MIRT800627	hsa-miR-3652	CLIP-seq
MIRT800628	hsa-miR-4262	CLIP-seq
MIRT800629	hsa-miR-4282	CLIP-seq
MIRT800630	hsa-miR-4291	CLIP-seq
MIRT800631	hsa-miR-4420	CLIP-seq
MIRT800632	hsa-miR-4430	CLIP-seq
MIRT800633	hsa-miR-4434	CLIP-seq
MIRT800610	hsa-miR-4492	CLIP-seq
MIRT800611	hsa-miR-4498	CLIP-seq
MIRT800634	hsa-miR-4508	CLIP-seq
MIRT800635	hsa-miR-4516	CLIP-seq
MIRT800636	hsa-miR-451b	CLIP-seq
MIRT800637	hsa-miR-4531	CLIP-seq
MIRT800638	hsa-miR-520a-5p	CLIP-seq
MIRT800639	hsa-miR-525-5p	CLIP-seq
MIRT800640	hsa-miR-545	CLIP-seq
MIRT800641	hsa-miR-558	CLIP-seq
MIRT800642	hsa-miR-663	CLIP-seq
MIRT800643	hsa-miR-744	CLIP-seq
MIRT800613	hsa-miR-762	CLIP-seq
MIRT800615	hsa-miR-155	CLIP-seq
MIRT800616	hsa-miR-181a	CLIP-seq
MIRT800617	hsa-miR-181b	CLIP-seq
MIRT800618	hsa-miR-181c	CLIP-seq
MIRT800619	hsa-miR-181d	CLIP-seq
MIRT1936492	hsa-miR-1825	CLIP-seq
MIRT1936493	hsa-miR-199a-5p	CLIP-seq
MIRT1936494	hsa-miR-199b-5p	CLIP-seq
MIRT1936495	hsa-miR-2115	CLIP-seq
MIRT800609	hsa-miR-3184	CLIP-seq
MIRT1936496	hsa-miR-3185	CLIP-seq
MIRT800626	hsa-miR-365	CLIP-seq
MIRT800628	hsa-miR-4262	CLIP-seq
MIRT800630	hsa-miR-4291	CLIP-seq
MIRT1936497	hsa-miR-4302	CLIP-seq
MIRT800610	hsa-miR-4492	CLIP-seq
MIRT800611	hsa-miR-4498	CLIP-seq
MIRT800612	hsa-miR-4505	CLIP-seq
MIRT800636	hsa-miR-451b	CLIP-seq
MIRT1936498	hsa-miR-4709-3p	CLIP-seq
MIRT800640	hsa-miR-545	CLIP-seq
MIRT800613	hsa-miR-762	CLIP-seq
MIRT1936495	hsa-miR-2115	CLIP-seq
MIRT800609	hsa-miR-3184	CLIP-seq
MIRT1936496	hsa-miR-3185	CLIP-seq
MIRT800610	hsa-miR-4492	CLIP-seq
MIRT800611	hsa-miR-4498	CLIP-seq
MIRT800612	hsa-miR-4505	CLIP-seq
MIRT800613	hsa-miR-762	CLIP-seq
MIRT1936495	hsa-miR-2115	CLIP-seq
MIRT800609	hsa-miR-3184	CLIP-seq
MIRT1936496	hsa-miR-3185	CLIP-seq

Show/Hide all (85)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IDA	37209686, 38175886
GO:0001664	Function	G protein-coupled receptor binding	IPI	10644702
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	IDA	37209686, 38175886
GO:0002029	Process	Desensitization of G protein-coupled receptor signaling pathway	IMP	12582207
GO:0002031	Process	G protein-coupled receptor internalization	IBA
GO:0002031	Process	G protein-coupled receptor internalization	IDA	10644702
GO:0002031	Process	G protein-coupled receptor internalization	IEA
GO:0002031	Process	G protein-coupled receptor internalization	IMP	12582207
GO:0002031	Process	G protein-coupled receptor internalization	TAS	24157794
GO:0002092	Process	Positive regulation of receptor internalization	IEA
GO:0002092	Process	Positive regulation of receptor internalization	IMP	22457824
GO:0005102	Function	Signaling receptor binding	IPI	18604210
GO:0005515	Function	Protein binding	IPI	12958365, 15125834, 16051150, 16378096, 16524428, 16820410, 17148612, 17620599, 19060904, 19122674, 19202075, 19363159, 19782076, 19955404, 20664520, 20802461, 22190034, 22282525, 22300987, 22457824, 23208550, 23341447, 23809162, 24157794, 24658140, 25241761, 25416956, 31515488, 319
GO:0005634	Component	Nucleus	IDA	16820410
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	26839314
GO:0005737	Component	Cytoplasm	IDA	12958365, 15611106, 16325578, 16820410, 23341447
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	18604210
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	21149639
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	16820410
GO:0007165	Process	Signal transduction	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	12958365
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	26839314
GO:0007628	Process	Adult walking behavior	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IC	10644702
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IMP	15878855
GO:0019233	Process	Sensory perception of pain	IBA
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0030139	Component	Endocytic vesicle	IDA	23341447
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	22810587
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	16378096
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	12958365, 15611106
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031623	Process	Receptor internalization	IDA	12958365
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	15878855
GO:0031701	Function	Angiotensin receptor binding	IBA
GO:0031701	Function	Angiotensin receptor binding	IEA
GO:0031701	Function	Angiotensin receptor binding	IPI	15611106
GO:0031748	Function	D1 dopamine receptor binding	IBA
GO:0031748	Function	D1 dopamine receptor binding	IPI	33571431
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	15125834, 16378096
GO:0032226	Process	Positive regulation of synaptic transmission, dopaminergic	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032695	Process	Negative regulation of interleukin-12 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	26839314
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	26839314
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	15878855
GO:0043422	Function	Protein kinase B binding	IEA
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IMP	18604210
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	21711983
GO:0060079	Process	Excitatory postsynaptic potential	NAS	21711983
GO:0060090	Function	Molecular adaptor activity	IDA	22810587, 26839314, 35817871, 37209686, 38175886
GO:0060326	Process	Cell chemotaxis	IMP	15635042
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	10644702
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	12582207
GO:0098794	Component	Postsynapse	IEA
GO:0098926	Process	Postsynaptic signal transduction	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0160213	Process	Beta-arrestin-dependent dopamine receptor signaling pathway	NAS	21711983
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA
GO:2000727	Process	Positive regulation of cardiac muscle cell differentiation	IEA

MIM	HGNC	e!Ensembl
107941	712	ENSG00000141480

P32121

Protein name

Beta-arrestin-2 (Arrestin beta-2) (Non-visual arrestin-3)

Protein function

Functions in regulating agonist-mediated G-protein coupled receptor (GPCR) signaling by mediating both receptor desensitization and resensitization processes. During homologous desensitization, beta-arrestins bind to the GPRK-phosphorylated rece

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00339	Arrestin_N	19 → 175	Arrestin (or S-antigen), N-terminal domain	Domain
PF02752	Arrestin_C	194 → 349	Arrestin (or S-antigen), C-terminal domain	Domain

Sequence

MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQS
AAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC

Sequence length

409

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Chemokine signaling pathway Endocytosis Hedgehog signaling pathway Dopaminergic synapse Olfactory transduction Relaxin signaling pathway Parathyroid hormone synthesis, secretion and action GnRH secretion Morphine addiction Chemical carcinogenesis - receptor activation		G alpha (s) signalling events Thrombin signalling through proteinase activated receptors (PARs) WNT5A-dependent internalization of FZD4 Activation of SMO MAP2K and MAPK activation Ub-specific processing proteases Signaling by moderate kinase activity BRAF mutants Signaling by high-kinase activity BRAF mutants Signaling by BRAF and RAF fusions Paradoxical activation of RAF signaling by kinase inactive BRAF Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis Signaling downstream of RAS mutants

ARRB2 (arrestin beta 2)