Gene Gene information from NCBI Gene database.
Entrez ID 4086
Gene name SMAD family member 1
Gene symbol SMAD1
Synonyms (NCBI Gene)
BSP-1BSP1JV4-1JV41MADH1MADR1
Chromosome 4
Chromosome location 4q31.21
Summary The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene `mothers against decapentaplegic` (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional mo
miRNA miRNA information provided by mirtarbase database.
227
miRTarBase ID miRNA Experiments Reference
MIRT001500 hsa-miR-155-5p Luciferase reporter assayqRT-PCRWestern blot 20427544
MIRT001500 hsa-miR-155-5p pSILAC 18668040
MIRT002340 hsa-miR-26a-5p Luciferase reporter assayWestern blot 18197755
MIRT002340 hsa-miR-26a-5p Luciferase reporter assayWestern blot 18197755
MIRT002340 hsa-miR-26a-5p Luciferase reporter assayWestern blot 18197755
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
GATA1 Unknown 22036566
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
106
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IEA
GO:0000785 Component Chromatin IDA 8653785
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 12270938, 20147459
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601595 6767 ENSG00000170365
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15797
Protein name Mothers against decapentaplegic homolog 1 (MAD homolog 1) (Mothers against DPP homolog 1) (JV4-1) (Mad-related protein 1) (SMAD family member 1) (SMAD 1) (Smad1) (hSMAD1) (Transforming growth factor-beta-signaling protein 1) (BSP-1)
Protein function Transcriptional modulator that plays a role in various cellular processes, including embryonic development, cell differentiation, and tissue homeostasis (PubMed:9335504). Upon BMP ligand binding to their receptors at the cell surface, is phospho
PDB 1KHU , 2LAW , 2LAX , 2LAY , 2LAZ , 2LB0 , 2LB1 , 3Q47 , 3Q4A , 5ZOK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03165 MH1 30 131 MH1 domain Domain
PF03166 MH2 269 441 MH2 domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highest expression seen in the heart and skeletal muscle.
Sequence
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVE
SPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
PMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLH
GPLQWLDKVLTQMGSPHNPISSVS
Sequence length 465
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Hormone signaling
TGF-beta signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Transcriptional misregulation in cancer
  Signaling by BMP
Ub-specific processing proteases
RUNX2 regulates bone development
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Pulmonary hypertension, primary, 1 Uncertain significance rs587777018 RCV000488453
SMAD1-related disorder Likely benign rs146090192 RCV003901576
Variant of unknown significance Uncertain significance rs587777018 RCV000054384
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Associate 18008360
Alzheimer Disease Associate 36764297
Aortic Valve Disease Associate 23968872
Arteriovenous Malformations Inhibit 36198763
Arthritis Rheumatoid Associate 26215036, 30046030
Breast Neoplasms Associate 36194598
Bronchiolitis Obliterans Syndrome Associate 26476349
Burkitt Lymphoma Associate 12967475
Carcinoma Non Small Cell Lung Associate 23154546
Carcinoma Ovarian Epithelial Associate 34110955