Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4072
Gene name	Epithelial cell adhesion molecule
Gene symbol	EPCAM
Synonyms (NCBI Gene)	Ber-Ep4BerEp4DIAR5EGP-2EGP314EGP40ESAHNPCC8KS1/4KSALYNCH8M4S1MIC18MK-1MOC-31TACSTD1TROP1
Chromosome	2
Chromosome location	2p21
Summary	This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calciu

Show/Hide all (14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs146480420	G>A,C	Likely-benign, benign-likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, synonymous variant
rs267606785	G>A	Pathogenic	Coding sequence variant, missense variant
rs369992289	C>A	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs373597944	G>A,C,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Splice acceptor variant
rs376155665	A>C,G,T	Pathogenic	Intron variant
rs397514661	C>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs606231203	G>A,T	Pathogenic	Splice donor variant
rs863224453	G>A	Likely-pathogenic	Splice acceptor variant
rs878854485	C>T	Pathogenic	Coding sequence variant, stop gained
rs878854488	G>A	Pathogenic	Coding sequence variant, stop gained
rs878854496	A>G	Likely-pathogenic	Splice acceptor variant
rs1324088403	C>A,T	Pathogenic	Missense variant, coding sequence variant, stop gained
rs1553342984	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1558438591	G>-	Pathogenic	Frameshift variant, coding sequence variant

123

Show/Hide all (123)

miRTarBase ID	miRNA	Experiments
MIRT966029	hsa-miR-103b	CLIP-seq
MIRT966030	hsa-miR-1248	CLIP-seq
MIRT966031	hsa-miR-1289	CLIP-seq
MIRT966032	hsa-miR-1290	CLIP-seq
MIRT966033	hsa-miR-1297	CLIP-seq
MIRT966034	hsa-miR-1299	CLIP-seq
MIRT966035	hsa-miR-1911	CLIP-seq
MIRT966036	hsa-miR-204	CLIP-seq
MIRT966037	hsa-miR-2054	CLIP-seq
MIRT966038	hsa-miR-211	CLIP-seq
MIRT966039	hsa-miR-26a	CLIP-seq
MIRT966040	hsa-miR-26b	CLIP-seq
MIRT966041	hsa-miR-297	CLIP-seq
MIRT966042	hsa-miR-3121-3p	CLIP-seq
MIRT966043	hsa-miR-3167	CLIP-seq
MIRT966044	hsa-miR-3198	CLIP-seq
MIRT966045	hsa-miR-323-3p	CLIP-seq
MIRT966046	hsa-miR-3617	CLIP-seq
MIRT966047	hsa-miR-3657	CLIP-seq
MIRT966048	hsa-miR-3662	CLIP-seq
MIRT966049	hsa-miR-3691-3p	CLIP-seq
MIRT966050	hsa-miR-3714	CLIP-seq
MIRT966051	hsa-miR-376a	CLIP-seq
MIRT966052	hsa-miR-376b	CLIP-seq
MIRT966053	hsa-miR-3924	CLIP-seq
MIRT966054	hsa-miR-3941	CLIP-seq
MIRT966055	hsa-miR-3942-3p	CLIP-seq
MIRT966056	hsa-miR-410	CLIP-seq
MIRT966057	hsa-miR-4294	CLIP-seq
MIRT966058	hsa-miR-4307	CLIP-seq
MIRT966059	hsa-miR-4309	CLIP-seq
MIRT966060	hsa-miR-4328	CLIP-seq
MIRT966061	hsa-miR-4432	CLIP-seq
MIRT966062	hsa-miR-4446-5p	CLIP-seq
MIRT966063	hsa-miR-4465	CLIP-seq
MIRT966064	hsa-miR-4534	CLIP-seq
MIRT966065	hsa-miR-4643	CLIP-seq
MIRT966066	hsa-miR-4659a-3p	CLIP-seq
MIRT966067	hsa-miR-4659b-3p	CLIP-seq
MIRT966068	hsa-miR-466	CLIP-seq
MIRT966069	hsa-miR-4669	CLIP-seq
MIRT966070	hsa-miR-4672	CLIP-seq
MIRT966071	hsa-miR-4676-5p	CLIP-seq
MIRT966072	hsa-miR-4693-5p	CLIP-seq
MIRT966073	hsa-miR-4705	CLIP-seq
MIRT966074	hsa-miR-4719	CLIP-seq
MIRT966075	hsa-miR-4755-5p	CLIP-seq
MIRT966076	hsa-miR-4775	CLIP-seq
MIRT966077	hsa-miR-4778-3p	CLIP-seq
MIRT966078	hsa-miR-4782-5p	CLIP-seq
MIRT966079	hsa-miR-4789-3p	CLIP-seq
MIRT966080	hsa-miR-495	CLIP-seq
MIRT966081	hsa-miR-498	CLIP-seq
MIRT966082	hsa-miR-513a-3p	CLIP-seq
MIRT966083	hsa-miR-516b	CLIP-seq
MIRT966084	hsa-miR-520d-5p	CLIP-seq
MIRT966085	hsa-miR-524-5p	CLIP-seq
MIRT966086	hsa-miR-548an	CLIP-seq
MIRT966087	hsa-miR-548l	CLIP-seq
MIRT966088	hsa-miR-548n	CLIP-seq
MIRT966089	hsa-miR-552	CLIP-seq
MIRT966090	hsa-miR-567	CLIP-seq
MIRT966091	hsa-miR-575	CLIP-seq
MIRT966092	hsa-miR-590-3p	CLIP-seq
MIRT966093	hsa-miR-592	CLIP-seq
MIRT966094	hsa-miR-599	CLIP-seq
MIRT966095	hsa-miR-623	CLIP-seq
MIRT966096	hsa-miR-641	CLIP-seq
MIRT966097	hsa-miR-662	CLIP-seq
MIRT966098	hsa-miR-876-5p	CLIP-seq
MIRT966081	hsa-miR-498	CLIP-seq
MIRT966033	hsa-miR-1297	CLIP-seq
MIRT1986121	hsa-miR-155	CLIP-seq
MIRT966035	hsa-miR-1911	CLIP-seq
MIRT966039	hsa-miR-26a	CLIP-seq
MIRT966040	hsa-miR-26b	CLIP-seq
MIRT966041	hsa-miR-297	CLIP-seq
MIRT966042	hsa-miR-3121-3p	CLIP-seq
MIRT1986122	hsa-miR-3190	CLIP-seq
MIRT966047	hsa-miR-3657	CLIP-seq
MIRT966053	hsa-miR-3924	CLIP-seq
MIRT966054	hsa-miR-3941	CLIP-seq
MIRT966055	hsa-miR-3942-3p	CLIP-seq
MIRT1986123	hsa-miR-4318	CLIP-seq
MIRT966061	hsa-miR-4432	CLIP-seq
MIRT966063	hsa-miR-4465	CLIP-seq
MIRT966065	hsa-miR-4643	CLIP-seq
MIRT966068	hsa-miR-466	CLIP-seq
MIRT966069	hsa-miR-4669	CLIP-seq
MIRT966070	hsa-miR-4672	CLIP-seq
MIRT966071	hsa-miR-4676-5p	CLIP-seq
MIRT966072	hsa-miR-4693-5p	CLIP-seq
MIRT966074	hsa-miR-4719	CLIP-seq
MIRT966079	hsa-miR-4789-3p	CLIP-seq
MIRT966081	hsa-miR-498	CLIP-seq
MIRT1986124	hsa-miR-509-3p	CLIP-seq
MIRT966082	hsa-miR-513a-3p	CLIP-seq
MIRT966084	hsa-miR-520d-5p	CLIP-seq
MIRT966085	hsa-miR-524-5p	CLIP-seq
MIRT966087	hsa-miR-548l	CLIP-seq
MIRT966088	hsa-miR-548n	CLIP-seq
MIRT966089	hsa-miR-552	CLIP-seq
MIRT966090	hsa-miR-567	CLIP-seq
MIRT966091	hsa-miR-575	CLIP-seq
MIRT966093	hsa-miR-592	CLIP-seq
MIRT966094	hsa-miR-599	CLIP-seq
MIRT1986125	hsa-miR-671-5p	CLIP-seq
MIRT1986126	hsa-miR-892a	CLIP-seq
MIRT966037	hsa-miR-2054	CLIP-seq
MIRT966041	hsa-miR-297	CLIP-seq
MIRT966050	hsa-miR-3714	CLIP-seq
MIRT966053	hsa-miR-3924	CLIP-seq
MIRT966061	hsa-miR-4432	CLIP-seq
MIRT966071	hsa-miR-4676-5p	CLIP-seq
MIRT966073	hsa-miR-4705	CLIP-seq
MIRT966081	hsa-miR-498	CLIP-seq
MIRT1986124	hsa-miR-509-3p	CLIP-seq
MIRT966086	hsa-miR-548an	CLIP-seq
MIRT966087	hsa-miR-548l	CLIP-seq
MIRT966088	hsa-miR-548n	CLIP-seq
MIRT966090	hsa-miR-567	CLIP-seq
MIRT966091	hsa-miR-575	CLIP-seq
MIRT966097	hsa-miR-662	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
DNMT1	Unknown	20940408
HDAC1	Unknown	20940408
NFKB1	Repression	11505407
RELA	Repression	11505407
ZEB1	Repression	23667256

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001657	Process	Ureteric bud development	IEA
GO:0005515	Function	Protein binding	IPI	16054130, 32814053
GO:0005886	Component	Plasma membrane	IDA	15195135, 19785009
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1729376
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IDA	16054130
GO:0005923	Component	Bicellular tight junction	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15195135
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	18025791
GO:0016324	Component	Apical plasma membrane	IDA	18025791
GO:0016328	Component	Lateral plasma membrane	IDA	16054130
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IMP	19136966
GO:0044877	Function	Protein-containing complex binding	IDA	19136966
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15195135, 15922867
GO:0048863	Process	Stem cell differentiation	IMP	19785009
GO:0070062	Component	Extracellular exosome	HDA	11487543, 19056867
GO:0070161	Component	Anchoring junction	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	IBA
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	9382878
GO:2000648	Process	Positive regulation of stem cell proliferation	IMP	19785009

MIM	HGNC	e!Ensembl
185535	11529	ENSG00000119888

P16422

Protein name

Epithelial cell adhesion molecule (Ep-CAM) (Adenocarcinoma-associated antigen) (Cell surface glycoprotein Trop-1) (Epithelial cell surface antigen) (Epithelial glycoprotein) (EGP) (Epithelial glycoprotein 314) (EGP314) (hEGP314) (KS 1/4 antigen) (KSA) (Ma

Protein function

May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infe

PDB

4MZV , 6I07

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18635	EpCAM_N	29 → 61	Epithelial cell adhesion molecule N-terminal domain	Domain
PF00086	Thyroglobulin_1	66 → 135	Thyroglobulin type-1 repeat	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes b

Sequence

MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS
KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN
TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF
ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL
DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA
EIKEMGEMHRELNA

Sequence length

314

Interactions

View interactions

	KEGG		Reactome
	Virion - Hepatitis viruses		Cell surface interactions at the vascular wall

688

Show/Hide Causal Diseases (12)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Carcinoma of colon	Pathogenic	rs2103756948, rs2103768437	RCV001354914 RCV001356897
Colon adenocarcinoma	Pathogenic	rs606231203	RCV005887487
Colonic neoplasm	Pathogenic	rs751264236	RCV001648492
Congenital diarrhea 5 with tufting enteropathy	Likely pathogenic; Pathogenic	rs376155665, rs606231281, rs606231203, rs267606785, rs606231204, rs1553342984, rs397514661, rs1324088403, rs747738988, rs987919056	RCV000763487 RCV000144937 RCV000013609 RCV000013611 RCV000013612 RCV000578221 RCV000033250 RCV000984490 RCV001250162 RCV001250163
EPCAM-related disorder	Likely pathogenic; Pathogenic	rs376155665, rs752808238, rs606231204, rs1385489500	RCV004751287 RCV003403838 RCV004751210 RCV004731540
Familial cancer of breast	Likely pathogenic; Pathogenic	rs376155665, rs752808238	RCV005359310 RCV004813207
Gastric cancer	Pathogenic; Likely pathogenic	rs2465457194, rs2465443187, rs2465443330, rs2465455020, rs2465455403, rs752808238, rs2465443167, rs2103747818, rs755113500, rs147494515, rs606231203, rs397514661	RCV003164605 RCV003164635 RCV003164650 RCV003164651 RCV003164652 RCV003164691 RCV003164704 RCV003164710 RCV003164714 RCV003164715 RCV003162250 RCV003162287
Hereditary cancer-predisposing syndrome	Pathogenic	rs606231203	RCV004018623
Hereditary nonpolyposis colorectal neoplasms	Pathogenic	rs1558438591	RCV000702462
Lynch syndrome 1	Likely pathogenic	rs2103770769	RCV002274255
Lynch syndrome 8	Likely pathogenic; Pathogenic	rs376155665	RCV000763487
Uterine corpus endometrial carcinoma	Pathogenic	rs606231203	RCV005887488

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Likely benign	rs138718438	RCV005890773
Astrocytoma IDH-mutant	Uncertain significance	rs1416156972	RCV003314729
Cervical cancer	Benign	rs114241106	RCV005890775
Familial pancreatic carcinoma	Benign	rs114241106	RCV005890776
Hereditary breast ovarian cancer syndrome	Uncertain significance	rs139208605, rs1671356501, rs1001841016	RCV001030691 RCV001030692 RCV001030693
Lymphoma	Benign	rs114241106	RCV005890778
Lynch syndrome	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign	rs146480420, rs587780557, rs190508047, rs587780765, rs587780766, rs587780770, rs587780771, rs150307203, rs730882126, rs863224712, rs863224840, rs864622092, rs878854490, rs768723264, rs886056131, rs886056132, rs376344699 View all (2 more)	RCV000123185 RCV000119233 RCV000123182 RCV000123187 RCV000123189 RCV000123195 RCV000123196 RCV000123200 RCV000161930 RCV000196090 RCV000196141 RCV000204981 RCV000231135 RCV000228632 RCV000344773 RCV000296752 RCV000374294
Malignant tumor of urinary bladder	Uncertain significance	rs201314303	RCV005893598
Nonpapillary renal cell carcinoma	Benign; Likely benign	rs138718438	RCV005890774
Ovarian cancer	Conflicting classifications of pathogenicity	rs149274310	RCV003154007
Ovarian serous cystadenocarcinoma	Benign	rs114241106	RCV005890779
Squamous cell carcinoma of the head and neck	Uncertain significance	rs1270650694	RCV005939428

Show/Hide Text Mining Associations (150)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	19443410, 20855955, 21415054, 22482828, 23348905, 23959111, 27432216, 32048177
Adenocarcinoma	Stimulate	26687301
Adenocarcinoma of Lung	Associate	19443410, 34731623
Adenoma	Inhibit	22388758
Adenoma Oxyphilic	Associate	17683191
Adenomyosis	Associate	37019419
Aicardi Syndrome	Associate	30389218
Ameloblastoma	Associate	35975801
Ascites	Associate	28679689, 36933411
Barrett Esophagus	Associate	16473928, 18688077
Biliary Atresia	Associate	30358741, 35774294
Brain Neoplasms	Associate	28820475
Breast Neoplasms	Associate	12031094, 12671691, 15305398, 15318937, 16457694, 16618718, 17785550, 19141643, 19633042, 19914540, 20012351, 21281469, 21370817, 21415054, 21816090 View all (37 more)
Breast Neoplasms	Stimulate	26356670, 28369094, 31545416
Cancer Pain	Associate	22547929
Carcinogenesis	Associate	15736402, 19443410, 22482828, 22989882, 23378578, 25502397, 26214441, 26984381, 31627983, 31658315, 33342796, 35288910
Carcinogenesis	Stimulate	25223521
Carcinoma	Associate	12439607, 21370592, 22331423, 24727741, 24992580, 25960617, 26299616, 35398623, 37236125, 40307718
Carcinoma	Stimulate	8006466
Carcinoma Adenoid Cystic	Associate	30389218
Carcinoma Adenosquamous	Associate	20855955
Carcinoma Basal Cell	Associate	26556851
Carcinoma Hepatocellular	Associate	19585654, 19686584, 20713493, 21464043, 21491582, 21737452, 23216644, 23879724, 24012616, 24086533, 24312415, 24616575, 24696843, 24718422, 25152593 View all (40 more)
Carcinoma Merkel Cell	Associate	29808366
Carcinoma Non Small Cell Lung	Associate	15153803, 19443410, 20980099, 22482828, 24061641, 24304228, 26317979, 26634471, 27459545, 27901069, 29286485, 30642547, 31092882, 31434250, 34455700, 36964516, 37312199 View all (2 more)
Carcinoma Non Small Cell Lung	Inhibit	29352248
Carcinoma Ovarian Epithelial	Associate	19574774, 20674962, 25045435, 31718609
Carcinoma Pancreatic Ductal	Associate	23947293, 27414409, 29045505, 33188144, 33836674, 34031415
Carcinoma Papillary	Stimulate	20053761
Carcinoma Papillary	Associate	35288910
Carcinoma Renal Cell	Associate	15221993, 17683191, 23180689, 23555683, 28820475, 31723229, 32392161
Carcinoma Squamous Cell	Associate	16796747, 22482828, 8774141
Carcinosarcoma	Associate	26474755
Cardiomyopathy Dilated	Associate	28701297
Central Nervous System Cysts	Associate	27431859
Cholangiocarcinoma	Associate	24086533, 24909871, 29497050, 32039729, 39831920
Cholangitis Sclerosing	Associate	25046437
Choriocarcinoma Non gestational	Associate	30070688
Chromosome Aberrations	Associate	29031565
Clear cell metastatic renal cell carcinoma	Associate	27101285
Colitis Ulcerative	Stimulate	28797042
Colonic Neoplasms	Associate	12100028, 14500642, 15756257, 23230278, 40597801
Colorectal Neoplasms	Associate	10205210, 11167991, 11315510, 12202902, 15570423, 15756257, 15816554, 16034560, 16404366, 17361206, 17579117, 17912244, 20135722, 20606680, 21145788 View all (28 more)
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	20864635, 21145788, 21227399, 21769135, 21791569, 24084575, 25133505, 25204323, 25963852, 26528695, 27363726, 27443514, 28489507, 28668538, 30238922 View all (18 more)
Colorectal Neoplasms Hereditary Nonpolyposis	Inhibit	22388758
Complex Regional Pain Syndromes	Associate	27431859
Craniopharyngioma	Associate	27431859
Crohn Disease	Associate	33201212
Cysts	Associate	18587325
Death	Associate	24304228, 28361844
Depressive Disorder	Associate	40508038
Diarrhea	Associate	28701297, 32293360, 34503561
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	18572020, 28361844, 28701297, 30461124, 32293360, 33433512
Disease	Associate	27302973
Drug Related Side Effects and Adverse Reactions	Associate	20053761, 25019346, 26474755, 35315504
Dysentery	Associate	30461124
End Stage Liver Disease	Associate	15870832
Endometrial Neoplasms	Associate	21145788, 24077349, 24084575, 24465008, 25963852, 27569206
Enterocolitis Necrotizing	Associate	36371157
Epidermodysplasia Verruciformis	Stimulate	24006432
Esophageal Neoplasms	Associate	26687301, 32255255
Esophageal Squamous Cell Carcinoma	Associate	16796747, 26897248
Esophageal Squamous Cell Carcinoma	Stimulate	26687301
Eye Neoplasms	Associate	24391761
Fatty Liver	Stimulate	27447573
Fibrosis	Associate	29637581
Gallbladder Neoplasms	Associate	26318430
Gastrointestinal Neoplasms	Associate	16034560
Genitourinary Tract Anomalies	Associate	21415054
Glioblastoma	Associate	35955533
Glioma	Associate	33269813
Glycosuria Renal	Associate	18383834
Head and Neck Neoplasms	Associate	16475692, 21355082, 22974215, 30275505
Hepatitis B	Associate	23519058, 24696843
Hepatoblastoma	Associate	28851352, 31627983
Hereditary Breast and Ovarian Cancer Syndrome	Associate	21129172
Idiopathic subglottic tracheal stenosis	Associate	35948078
Immunologic Deficiency Syndromes	Associate	21145788, 21791569, 26528695
Inflammation	Associate	37192201
Inflammatory Bowel Diseases	Associate	33201212, 38415550
Intestinal Polyposis	Associate	25204323
Kidney Diseases Cystic	Associate	27431859
Liver Cirrhosis	Stimulate	28572700
Liver Diseases	Associate	28361844
Liver Neoplasms	Associate	19585654, 27447573
Lung Neoplasms	Associate	21370817, 21829190, 23959111, 24304228, 24886394, 26698569, 27901069, 29186152, 34964211, 35542175, 35711455, 40597801
Lymphangioleiomyomatosis	Associate	27016587
Lymphatic Metastasis	Stimulate	18383834, 23830302, 26698569, 28336725, 32212818
Lymphatic Metastasis	Associate	24422715, 28820475, 31443698, 32048177, 40307718
Lymphoma Non Hodgkin	Associate	25152593
Malaria	Associate	30115931
Massive Hepatic Necrosis	Stimulate	23185381
Melanoma	Associate	28883519
Mesothelioma Malignant	Associate	22086445, 37069606
Nasopharyngeal Carcinoma	Associate	35169126
Nasopharyngeal Neoplasms	Associate	31822892
Necrosis	Associate	28668853
Neoplasm Invasiveness	Associate	15153803, 25550831, 35288910
Neoplasm Metastasis	Associate	17785550, 19633042, 20012351, 21415054, 22447185, 24422715, 26356670, 26687301, 30104180, 31443698, 32212818, 33269813, 34528562, 34983878, 35315504, 40597801 View all (1 more)
Neoplasm Metastasis	Inhibit	23180689
Neoplasm Metastasis	Stimulate	30389218
Neoplasm Micrometastasis	Associate	37312199
Neoplasms	Associate	10646907, 11315510, 12031094, 12100028, 12439607, 12671691, 14573783, 15548373, 15736402, 15816554, 15870832, 16404366, 16475692, 16796747, 17273869 View all (163 more)
Neoplasms	Inhibit	22388758, 35265204
Neoplasms	Stimulate	26356670, 31471413, 33433512
Neoplasms Cystic Mucinous and Serous	Associate	20053761, 26272866
Neoplasms Cystic Mucinous and Serous	Stimulate	25045435
Neoplasms Fibroepithelial	Associate	25687451
Neoplasms Glandular and Epithelial	Associate	19141643, 23594482
Neoplasms Squamous Cell	Associate	26571236
Neoplastic Cells Circulating	Associate	23497487, 27013581, 27432216
Neuroblastoma	Associate	30104180
Ovarian Diseases	Associate	19574774, 20870202, 26191160, 26474755, 37094499
Ovarian Neoplasms	Associate	19574774, 20674962, 20870202, 20952655, 21694727, 23011824, 23403823, 24465008, 24528603, 24752081, 25045435, 25251053, 26191160, 27323861, 31752757 View all (5 more)
Ovarian Neoplasms	Stimulate	24489952
Pancreatic Intraductal Neoplasms	Associate	23594482
Pancreatic Neoplasms	Associate	20426768, 23594482, 23679813, 24521357, 25240521, 31317745, 31911225
Pancreatitis	Associate	33836674
Paroxysmal nonkinesigenic dyskinesia	Associate	28875602
Personality Disorders	Associate	15870832, 26609030
Pituitary Neoplasms	Associate	25550831
Pleural Effusion	Associate	21595914
Pleural Effusion Malignant	Associate	30642547
Prostate cancer familial	Associate	29095436
Prostatic Neoplasms	Associate	16404366, 19850885, 20598135, 24705864, 24727373, 24992580, 31514447, 31738404, 35315504, 37055551
Prostatic Neoplasms Castration Resistant	Associate	24705864
Prostatitis	Associate	24992580, 25514598, 35288910
Pyruvate Carboxylase Deficiency Disease	Associate	35315504
Rectal Neoplasms	Associate	17361206
Retinal Dysplasia	Stimulate	26687301, 33433512
Retinal Vein Occlusion	Associate	32212818
Retinitis Pigmentosa	Associate	18383834
Retinoblastoma	Associate	20461151, 22328825, 22969266, 23213278, 23687439, 24391761, 25502397
Sjogren's Syndrome	Associate	31886299
Small Cell Lung Carcinoma	Associate	36517551, 36869231, 37303738
Squamous Cell Carcinoma of Head and Neck	Associate	22447185, 23625795, 25043563, 31361893, 31822892, 32300118, 32814771, 33340247, 33433512, 37236125
Stomach Neoplasms	Associate	15870832, 23830302, 24008668, 24422715, 26774363, 27557490, 32816956
Tertiary Lymphoid Structures	Associate	24422715, 37312199
Thrombosis	Associate	24718422
Thyroid Cancer Papillary	Associate	26678979, 31658315, 35288910, 40307718
Thyroid Carcinoma Anaplastic	Associate	24727741
Thyroid Neoplasms	Associate	20579375, 23049733
Triple Negative Breast Neoplasms	Associate	28870198, 33342796, 39520925
Tuberculosis Meningeal	Associate	28875602
Urethral Neoplasms	Associate	18383834, 32212383, 37154925
Urinary Bladder Neoplasms	Associate	25223521, 25719831, 28321147
Urologic Neoplasms	Associate	31615790
Uterine Cervical Dysplasia	Associate	8774141
Uterine Cervical Neoplasms	Associate	36674577
Uterine Cervicitis	Associate	21370592

EPCAM (epithelial cell adhesion molecule)