Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4067
Gene name Gene Name - the full gene name approved by the HGNC.	LYN proto-oncogene, Src family tyrosine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LYN
Synonyms (NCBI Gene) Gene synonyms aliases	JTK8, SAIDV, p53Lyn, p56Lyn
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q12.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a tyrosine protein kinase, which maybe involved in the regulation of mast cell degranulation, and erythroid differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided b

Show/Hide all(117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046575	hsa-miR-222-3p	CLASH	23622248
MIRT322915	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT322916	hsa-miR-4731-3p	PAR-CLIP	20371350
MIRT322917	hsa-miR-4801	PAR-CLIP	20371350
MIRT570814	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT570813	hsa-miR-4643	PAR-CLIP	20371350
MIRT570812	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT570811	hsa-miR-548v	PAR-CLIP	20371350
MIRT570810	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT046575	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT570809	hsa-miR-466	PAR-CLIP	20371350
MIRT570808	hsa-miR-628-5p	PAR-CLIP	20371350
MIRT322922	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT473950	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT473949	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT473948	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT473947	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT473946	hsa-miR-10b-3p	PAR-CLIP	23592263
MIRT473945	hsa-miR-4330	PAR-CLIP	23592263
MIRT473944	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT473943	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT473942	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT473941	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT473940	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT473939	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT473938	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT473937	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT473936	hsa-miR-4458	PAR-CLIP	23592263
MIRT473935	hsa-miR-4500	PAR-CLIP	23592263
MIRT473934	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT473932	hsa-miR-3148	PAR-CLIP	23592263
MIRT473933	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT473931	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT473930	hsa-miR-4278	PAR-CLIP	23592263
MIRT473929	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT473928	hsa-miR-3122	PAR-CLIP	23592263
MIRT473927	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT473926	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT440300	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT440300	hsa-miR-205-5p	HITS-CLIP	22473208
MIRT322915	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT322916	hsa-miR-4731-3p	PAR-CLIP	20371350
MIRT322917	hsa-miR-4801	PAR-CLIP	20371350
MIRT570814	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT570813	hsa-miR-4643	PAR-CLIP	20371350
MIRT570812	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT570811	hsa-miR-548v	PAR-CLIP	20371350
MIRT570810	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT046575	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT570809	hsa-miR-466	PAR-CLIP	20371350
MIRT570808	hsa-miR-628-5p	PAR-CLIP	20371350
MIRT322922	hsa-miR-548c-3p	PAR-CLIP	23592263
MIRT473950	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT473949	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT473948	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT473947	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT473946	hsa-miR-10b-3p	PAR-CLIP	23592263
MIRT473945	hsa-miR-4330	PAR-CLIP	23592263
MIRT473944	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT473943	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT473942	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT473941	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT473940	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT473939	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT473938	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT473937	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT473936	hsa-miR-4458	PAR-CLIP	23592263
MIRT473935	hsa-miR-4500	PAR-CLIP	23592263
MIRT473934	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT473932	hsa-miR-3148	PAR-CLIP	23592263
MIRT473933	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT473931	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT473930	hsa-miR-4278	PAR-CLIP	23592263
MIRT473929	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT473928	hsa-miR-3122	PAR-CLIP	23592263
MIRT473927	hsa-miR-3913-5p	PAR-CLIP	23592263
MIRT473926	hsa-miR-6513-5p	PAR-CLIP	23592263
MIRT1123088	hsa-miR-1200	CLIP-seq
MIRT1123089	hsa-miR-1237	CLIP-seq
MIRT1123090	hsa-miR-1248	CLIP-seq
MIRT1123091	hsa-miR-1303	CLIP-seq
MIRT1123092	hsa-miR-1976	CLIP-seq
MIRT1123093	hsa-miR-2116	CLIP-seq
MIRT1123094	hsa-miR-3190	CLIP-seq
MIRT1123095	hsa-miR-3201	CLIP-seq
MIRT1123096	hsa-miR-3591-5p	CLIP-seq
MIRT1123097	hsa-miR-3606	CLIP-seq
MIRT1123098	hsa-miR-3646	CLIP-seq
MIRT1123099	hsa-miR-4282	CLIP-seq
MIRT1123100	hsa-miR-4324	CLIP-seq
MIRT1123101	hsa-miR-4496	CLIP-seq
MIRT1123102	hsa-miR-4677-5p	CLIP-seq
MIRT1123103	hsa-miR-4700-3p	CLIP-seq
MIRT1123104	hsa-miR-4715-3p	CLIP-seq
MIRT1123105	hsa-miR-4722-3p	CLIP-seq
MIRT1123106	hsa-miR-4752	CLIP-seq
MIRT1123107	hsa-miR-4768-3p	CLIP-seq
MIRT1123108	hsa-miR-4791	CLIP-seq
MIRT1123109	hsa-miR-4799-5p	CLIP-seq
MIRT1123110	hsa-miR-5095	CLIP-seq
MIRT1123111	hsa-miR-544b	CLIP-seq
MIRT1123112	hsa-miR-600	CLIP-seq
MIRT1123113	hsa-miR-609	CLIP-seq
MIRT1123114	hsa-miR-877	CLIP-seq
MIRT1123115	hsa-miR-921	CLIP-seq
MIRT2034745	hsa-miR-3622a-3p	CLIP-seq
MIRT2034746	hsa-miR-3622b-3p	CLIP-seq
MIRT2034747	hsa-miR-412	CLIP-seq
MIRT2034748	hsa-miR-617	CLIP-seq
MIRT2265253	hsa-miR-2278	CLIP-seq
MIRT2265254	hsa-miR-2467-5p	CLIP-seq
MIRT2265255	hsa-miR-3188	CLIP-seq
MIRT2265256	hsa-miR-3975	CLIP-seq
MIRT2265257	hsa-miR-4303	CLIP-seq
MIRT2265258	hsa-miR-4649-3p	CLIP-seq
MIRT2265259	hsa-miR-4762-3p	CLIP-seq
MIRT2265260	hsa-miR-485-5p	CLIP-seq

Show/Hide all(205)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IDA	10891478
GO:0000166	Function	Nucleotide binding	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0001782	Process	B cell homeostasis	ISS
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0001817	Process	Regulation of cytokine production	ISS
GO:0001932	Process	Regulation of protein phosphorylation	TAS	15489917
GO:0001933	Process	Negative regulation of protein phosphorylation	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IMP	16467205
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002431	Process	Fc receptor mediated stimulatory signaling pathway	IBA
GO:0002431	Process	Fc receptor mediated stimulatory signaling pathway	IEA
GO:0002431	Process	Fc receptor mediated stimulatory signaling pathway	ISS
GO:0002513	Process	Tolerance induction to self antigen	IBA
GO:0002513	Process	Tolerance induction to self antigen	IEA
GO:0002513	Process	Tolerance induction to self antigen	ISS
GO:0002513	Process	Tolerance induction to self antigen	TAS	15489917
GO:0002553	Process	Histamine secretion by mast cell	IEA
GO:0002576	Process	Platelet degranulation	IEA
GO:0002576	Process	Platelet degranulation	ISS
GO:0002758	Process	Innate immune response-activating signaling pathway	IEA
GO:0002762	Process	Negative regulation of myeloid leukocyte differentiation	IEA
GO:0002768	Process	Immune response-regulating cell surface receptor signaling pathway	IEA
GO:0002768	Process	Immune response-regulating cell surface receptor signaling pathway	ISS
GO:0002768	Process	Immune response-regulating cell surface receptor signaling pathway	TAS	15489917
GO:0002774	Process	Fc receptor mediated inhibitory signaling pathway	IEA
GO:0002774	Process	Fc receptor mediated inhibitory signaling pathway	ISS
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0002902	Process	Regulation of B cell apoptotic process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	1381360, 7526393, 9799234, 10861086, 11110698, 11358993, 11448999, 12670955, 12923167, 16921024, 18697750
GO:0004713	Function	Protein tyrosine kinase activity	IDA	7682714, 10748115, 11823534, 32958780
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IMP	36122175, 36932076
GO:0004713	Function	Protein tyrosine kinase activity	TAS	3561390
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IMP	23555801
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	TAS
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005161	Function	Platelet-derived growth factor receptor binding	IEA
GO:0005178	Function	Integrin binding	IEA
GO:0005515	Function	Protein binding	IPI	1715582, 7859737, 8647200, 8753773, 9020138, 11306681, 11517336, 11782428, 14993658, 15546919, 15784897, 16155203, 16374509, 16799092, 17254966, 17640867, 18070987, 19940238, 20037584, 20159608, 21930792, 22581261, 22624718, 22731636, 22939624, 23001182, 23764002, 23866081, 24658140
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	18817770
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005794	Component	Golgi apparatus	IDA	15173188, 20605918
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	32958780
GO:0005886	Component	Plasma membrane	IDA	15173188, 20605918
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IEA
GO:0006468	Process	Protein phosphorylation	IDA	11517336
GO:0006468	Process	Protein phosphorylation	TAS	3561390
GO:0006914	Process	Autophagy	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006974	Process	DNA damage response	IBA
GO:0006974	Process	DNA damage response	IDA	11517336
GO:0006991	Process	Response to sterol depletion	IEA
GO:0007165	Process	Signal transduction	TAS	7650013
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IMP	14726379
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	14726379
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0009725	Process	Response to hormone	IEA
GO:0009725	Process	Response to hormone	ISS
GO:0009743	Process	Response to carbohydrate	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	11823534
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0015908	Process	Fatty acid transport	IDA	32958780
GO:0015908	Process	Fatty acid transport	IDA	32958780
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016301	Function	Kinase activity	NAS	24217950
GO:0016740	Function	Transferase activity	IEA
GO:0017124	Function	SH3 domain binding	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	7682714, 11782428
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	20605918
GO:0030061	Component	Mitochondrial crista	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	ISS
GO:0030222	Process	Eosinophil differentiation	IDA	11823534
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030546	Function	Signaling receptor activator activity	IDA	24217950
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030889	Process	Negative regulation of B cell proliferation	IEA
GO:0031175	Process	Neuron projection development	IBA
GO:0031175	Process	Neuron projection development	IEA
GO:0031295	Process	T cell costimulation	TAS
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	ISS
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033003	Process	Regulation of mast cell activation	IEA
GO:0033003	Process	Regulation of mast cell activation	ISS
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IMP	18802065
GO:0034136	Process	Negative regulation of toll-like receptor 2 signaling pathway	IEA
GO:0034136	Process	Negative regulation of toll-like receptor 2 signaling pathway	ISS
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IEA
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	IEA
GO:0034144	Process	Negative regulation of toll-like receptor 4 signaling pathway	ISS
GO:0034605	Process	Cellular response to heat	IEA
GO:0034666	Component	Integrin alpha2-beta1 complex	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IDA	11823534
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0038159	Process	C-X-C chemokine receptor CXCR4 signaling pathway	IMP	16467205
GO:0042100	Process	B cell proliferation	ISS
GO:0042100	Process	B cell proliferation	ISS
GO:0042327	Process	Positive regulation of phosphorylation	IEA
GO:0043015	Function	Gamma-tubulin binding	IEA
GO:0043200	Process	Response to amino acid	IEA
GO:0043208	Function	Glycosphingolipid binding	IEA
GO:0043304	Process	Regulation of mast cell degranulation	IEA
GO:0043304	Process	Regulation of mast cell degranulation	ISS
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	10891478
GO:0043434	Process	Response to peptide hormone	IEA
GO:0044325	Function	Transmembrane transporter binding	IPI	12538589
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045121	Component	Membrane raft	IDA	11313396
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045646	Process	Regulation of erythrocyte differentiation	IEA
GO:0045646	Process	Regulation of erythrocyte differentiation	ISS
GO:0046777	Process	Protein autophosphorylation	IDA	7682714
GO:0046875	Function	Ephrin receptor binding	IPI	24217950
GO:0048013	Process	Ephrin receptor signaling pathway	IGI	24217950
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20605918
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050777	Process	Negative regulation of immune response	TAS	15489917
GO:0050853	Process	B cell receptor signaling pathway	IEA
GO:0050855	Process	Regulation of B cell receptor signaling pathway	IBA
GO:0050855	Process	Regulation of B cell receptor signaling pathway	IEA
GO:0050855	Process	Regulation of B cell receptor signaling pathway	ISS
GO:0050859	Process	Negative regulation of B cell receptor signaling pathway	IDA	1711157, 35941532
GO:0050900	Process	Leukocyte migration	IEA
GO:0050900	Process	Leukocyte migration	TAS
GO:0051219	Function	Phosphoprotein binding	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0060369	Process	Positive regulation of Fc receptor mediated stimulatory signaling pathway	IEA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IEA
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0070447	Process	Positive regulation of oligodendrocyte progenitor proliferation	IEA
GO:0070667	Process	Negative regulation of mast cell proliferation	IEA
GO:0070667	Process	Negative regulation of mast cell proliferation	ISS
GO:0070668	Process	Positive regulation of mast cell proliferation	IMP	11435302
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947
GO:0071396	Process	Cellular response to lipid	IEA
GO:0090025	Process	Regulation of monocyte chemotaxis	IMP	18802065
GO:0090330	Process	Regulation of platelet aggregation	IEA
GO:0090330	Process	Regulation of platelet aggregation	ISS
GO:0097028	Process	Dendritic cell differentiation	IBA
GO:0097028	Process	Dendritic cell differentiation	IEA
GO:0097028	Process	Dendritic cell differentiation	ISS
GO:0097110	Function	Scaffold protein binding	IPI	23555801
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099091	Component	Postsynaptic specialization, intracellular component	IEA
GO:0140031	Function	Phosphorylation-dependent protein binding	IPI	11782428
GO:0141038	Function	Phosphatidylinositol 3-kinase activator activity	IEA
GO:0150076	Process	Neuroinflammatory response	IEA
GO:1902532	Process	Negative regulation of intracellular signal transduction	IEA
GO:1902532	Process	Negative regulation of intracellular signal transduction	ISS
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IMP	24217950
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IMP	31649195
GO:2000670	Process	Positive regulation of dendritic cell apoptotic process	IEA
GO:2000670	Process	Positive regulation of dendritic cell apoptotic process	ISS

MIM	HGNC	e!Ensembl
165120	6735	ENSG00000254087

Protein

UniProt ID

P07948

Protein name

Tyrosine-protein kinase Lyn (EC 2.7.10.2) (Lck/Yes-related novel protein tyrosine kinase) (V-yes-1 Yamaguchi sarcoma viral related oncogene homolog) (p53Lyn) (p56Lyn)

Protein function

Non-receptor tyrosine-protein kinase that transmits signals from cell surface receptors and plays an important role in the regulation of innate and adaptive immune responses, hematopoiesis, responses to growth factors and cytokines, integrin sig

PDB

1W1F , 1WA7 , 3A4O , 5XY1 , 6NMW , 8WFF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	69 → 115	SH3 domain	Domain
PF00017	SH2	129 → 211	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	247 → 497	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in monocytes (at protein level). Detected in placenta, and in fetal brain, lung, liver and kidney. Widely expressed in a variety of organs, tissues, and cell types such as epidermoid, hematopoietic, and neuronal cells. Express

Sequence

MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP

Sequence length

512

Interactions

View interactions

	KEGG		Reactome
	Chemokine signaling pathway NF-kappa B signaling pathway Platelet activation B cell receptor signaling pathway Fc epsilon RI signaling pathway Fc gamma R-mediated phagocytosis Long-term depression Epithelial cell signaling in Helicobacter pylori infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Viral carcinogenesis Lipid and atherosclerosis		GPVI-mediated activation cascade Signaling by SCF-KIT Regulation of KIT signaling Cell surface interactions at the vascular wall FCGR activation PECAM1 interactions Fc epsilon receptor (FCERI) signaling Role of LAT2/NTAL/LAB on calcium mobilization FCERI mediated MAPK activation FCERI mediated Ca+2 mobilization FCERI mediated NF-kB activation CD28 co-stimulation CTLA4 inhibitory signaling EPHB-mediated forward signaling EPHA-mediated growth cone collapse EPH-ephrin mediated repulsion of cells Dectin-2 family CD209 (DC-SIGN) signaling CD22 mediated BCR regulation Cyclin D associated events in G1 Platelet Adhesion to exposed collagen Erythropoietin activates Phosphoinositide-3-kinase (PI3K) Erythropoietin activates RAS Regulation of signaling by CBL FCGR3A-mediated IL10 synthesis FCGR3A-mediated phagocytosis Growth hormone receptor signaling

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Autoinflammatory Disease	autoinflammatory disease, systemic, with vasculitis	N/A	N/A	GenCC
Insomnia	Insomnia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (100)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	26708841, 27756880, 36991000
Adenocarcinoma of Lung	Associate	23866081, 27756880
Anovulation	Associate	40287692
Atherosclerosis	Associate	28260035, 34122426
Autoimmune Diseases	Associate	36215934, 36267464
Bone Resorption	Associate	9844106
Brain Ischemia	Associate	33460396
Breast Neoplasms	Associate	20215510, 30969999
Bruton type agammaglobulinemia	Associate	10688822
Burkitt Lymphoma	Associate	26731115
Carcinoma Mucoepidermoid	Associate	23018873
Carcinoma Renal Cell	Associate	26984511, 40612864
Carotid Stenosis	Associate	28260035, 37644056
Colorectal Neoplasms	Associate	22731636, 35103068, 35414768, 40156411
Coronary Artery Disease	Associate	31886261
COVID 19	Associate	36052061
Diabetes Mellitus	Associate	35628588
Diabetes Mellitus Type 2	Associate	24455749
Diabetic Nephropathies	Associate	32778679
Drug Related Side Effects and Adverse Reactions	Associate	31028876
Epilepsy Temporal Lobe	Associate	38166692
Fetal Growth Retardation	Associate	35090410
Gallbladder Neoplasms	Associate	37108401
Glioblastoma	Associate	22323579, 26744869
Glioma	Associate	35628503
Granulomatous Disease Chronic	Inhibit	8798554
Hematologic Diseases	Associate	19369946
Hepatitis B	Stimulate	19290526
Hepatitis B	Associate	24352878
Hodgkin Disease	Associate	12881301
Hypoxia Brain	Associate	35150959
Infections	Associate	21345943
Inflammation	Associate	33999861, 35103068, 36267464, 36899005, 36932076, 38256136
Inflammatory Bowel Diseases	Associate	36643579
Intervertebral Disc Degeneration	Associate	36193061
Kidney Neoplasms	Associate	26984511
Leukemia	Associate	10658677, 15175350, 1638019, 17218385, 20564182, 22768161, 26308964, 29153093, 30969999, 36899005, 8611704
Leukemia	Stimulate	15650771
Leukemia Lymphocytic Chronic B Cell	Associate	15650771, 20159608, 22768161, 24352878, 24532043, 36899005
Leukemia Lymphocytic Chronic B Cell	Stimulate	19290526
Leukemia Lymphoma Adult T Cell	Stimulate	19131553
Leukemia Lymphoma Adult T Cell	Associate	20370541
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	15502840, 18235045, 20583816, 20693279, 21730355, 31881245
Leukemia Myeloid	Associate	1638019, 34836491
Leukemia Myeloid Acute	Associate	18056483, 20693279, 24404189, 26065685, 29153093, 31790499, 33592500, 34207065
Leukemia Prolymphocytic T Cell	Stimulate	19290526
Leukemia Prolymphocytic T Cell	Associate	28419476
Leukemia Promyelocytic Acute	Associate	26886259
Leukemia T Cell	Associate	1379847, 19290526
Leukopenia	Associate	31028876
Liver Cirrhosis	Associate	36932076
Lupus Erythematosus Systemic	Inhibit	16320343, 23450709
Lupus Erythematosus Systemic	Associate	17195233, 19369946
Lymphatic Metastasis	Associate	40156411
Lymphoma Follicular	Associate	35030632
Lymphoma Mantle Cell	Associate	18070987
Lymphoma Non Hodgkin	Associate	18070987
Mastocytosis	Associate	21108325
Mastocytosis Systemic	Associate	21680801
Melanoma	Associate	30969999
Mitochondrial Diseases	Associate	15175350
Mouth Neoplasms	Associate	25029526
Myelodysplastic Syndromes	Associate	19290526
Neoplasm Invasiveness	Associate	20215510
Neoplasm Metastasis	Associate	22731636, 26460485, 27690342, 35103068
Neoplasm Metastasis	Stimulate	40156411
Neoplasms	Associate	19290526, 19359472, 21680801, 23383610, 25482942, 25817574, 26460485, 26708841, 29153093, 30969999, 35103068, 35628503, 36899005, 36991000, 38256136, 40156411 View all (1 more)
Neoplasms	Stimulate	27690342, 29188362
Neuroacanthocytosis	Associate	21951684
Obesity	Associate	24455749
Ovarian Neoplasms	Associate	23383610
Pancreatic Neoplasms	Associate	33213062
Peri Implantitis	Associate	36267464
Periodontitis	Associate	40016711
Plaque Atherosclerotic	Stimulate	26742467
Plaque Atherosclerotic	Associate	28260035
Polycystic Ovary Syndrome	Stimulate	28949383
Polycystic Ovary Syndrome	Associate	40287692
Polycythemia Vera	Associate	24404189
Pre Eclampsia	Associate	26388242, 40016711
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10658677, 22895079, 28408464
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	16029452, 16644881
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	19290526
Prostatic Neoplasms	Associate	24817628
Prostatic Neoplasms Castration Resistant	Associate	25592164
Psoriasis	Associate	34122426
Ring Chromosome 20 Syndrome	Associate	20693279
Sarcoma	Associate	22461510
Seizures	Associate	38166692
Smoke Inhalation Injury	Associate	28816646
Squamous Cell Carcinoma of Head and Neck	Associate	12771142, 24192080
Stomach Neoplasms	Associate	26460485, 31828293
Tertiary Lymphoid Structures	Associate	22731636
Triple Negative Breast Neoplasms	Associate	25482942
Tuberculosis	Associate	31028876
Urinary Bladder Neoplasms	Associate	34517533
Uterine Cervical Dysplasia	Associate	36991000
Uterine Cervical Neoplasms	Associate	27690342, 33829064
Vasculitis Lymphocytic Cutaneous Small Vessel	Associate	36932076
Waldenstrom Macroglobulinemia	Associate	24366360, 35255496

LYN (LYN proto-oncogene, Src family tyrosine kinase)