Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	4062
Gene name	Lymphocyte antigen 6 family member H
Gene symbol	LY6H
Synonyms (NCBI Gene)	NMLY6
Chromosome	8
Chromosome location	8q24.3

106

Show/Hide all (106)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017464	hsa-miR-335-5p	Microarray	18185580
MIRT568879	hsa-miR-4524b-3p	PAR-CLIP	20371350
MIRT568878	hsa-miR-1321	PAR-CLIP	20371350
MIRT568876	hsa-miR-4739	PAR-CLIP	20371350
MIRT568877	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT568875	hsa-miR-4270	PAR-CLIP	20371350
MIRT568874	hsa-miR-4441	PAR-CLIP	20371350
MIRT568873	hsa-miR-6754-5p	PAR-CLIP	20371350
MIRT568872	hsa-miR-5739	PAR-CLIP	20371350
MIRT568871	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT568870	hsa-miR-4487	PAR-CLIP	20371350
MIRT568869	hsa-miR-3188	PAR-CLIP	20371350
MIRT568868	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT568867	hsa-miR-4306	PAR-CLIP	20371350
MIRT568865	hsa-miR-4644	PAR-CLIP	20371350
MIRT568866	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT568864	hsa-miR-4730	PAR-CLIP	20371350
MIRT568878	hsa-miR-1321	PAR-CLIP	27292025
MIRT568878	hsa-miR-1321	PAR-CLIP	27292025
MIRT568878	hsa-miR-1321	PAR-CLIP	27292025
MIRT568878	hsa-miR-1321	PAR-CLIP	27292025
MIRT568868	hsa-miR-185-5p	PAR-CLIP	27292025
MIRT568868	hsa-miR-185-5p	PAR-CLIP	27292025
MIRT568868	hsa-miR-185-5p	PAR-CLIP	27292025
MIRT568868	hsa-miR-185-5p	PAR-CLIP	27292025
MIRT568866	hsa-miR-25-5p	PAR-CLIP	27292025
MIRT568866	hsa-miR-25-5p	PAR-CLIP	27292025
MIRT568866	hsa-miR-25-5p	PAR-CLIP	27292025
MIRT568866	hsa-miR-25-5p	PAR-CLIP	27292025
MIRT568869	hsa-miR-3188	PAR-CLIP	27292025
MIRT568869	hsa-miR-3188	PAR-CLIP	27292025
MIRT568869	hsa-miR-3188	PAR-CLIP	27292025
MIRT568869	hsa-miR-3188	PAR-CLIP	27292025
MIRT568875	hsa-miR-4270	PAR-CLIP	27292025
MIRT568875	hsa-miR-4270	PAR-CLIP	27292025
MIRT568875	hsa-miR-4270	PAR-CLIP	27292025
MIRT568875	hsa-miR-4270	PAR-CLIP	27292025
MIRT568867	hsa-miR-4306	PAR-CLIP	27292025
MIRT568867	hsa-miR-4306	PAR-CLIP	27292025
MIRT568867	hsa-miR-4306	PAR-CLIP	27292025
MIRT568867	hsa-miR-4306	PAR-CLIP	27292025
MIRT568874	hsa-miR-4441	PAR-CLIP	27292025
MIRT568874	hsa-miR-4441	PAR-CLIP	27292025
MIRT568874	hsa-miR-4441	PAR-CLIP	27292025
MIRT568874	hsa-miR-4441	PAR-CLIP	27292025
MIRT568870	hsa-miR-4487	PAR-CLIP	27292025
MIRT568870	hsa-miR-4487	PAR-CLIP	27292025
MIRT568870	hsa-miR-4487	PAR-CLIP	27292025
MIRT568870	hsa-miR-4487	PAR-CLIP	27292025
MIRT568871	hsa-miR-4524a-3p	PAR-CLIP	27292025
MIRT568871	hsa-miR-4524a-3p	PAR-CLIP	27292025
MIRT568871	hsa-miR-4524a-3p	PAR-CLIP	27292025
MIRT568871	hsa-miR-4524a-3p	PAR-CLIP	27292025
MIRT568879	hsa-miR-4524b-3p	PAR-CLIP	27292025
MIRT568879	hsa-miR-4524b-3p	PAR-CLIP	27292025
MIRT568879	hsa-miR-4524b-3p	PAR-CLIP	27292025
MIRT568879	hsa-miR-4524b-3p	PAR-CLIP	27292025
MIRT568865	hsa-miR-4644	PAR-CLIP	27292025
MIRT568865	hsa-miR-4644	PAR-CLIP	27292025
MIRT568865	hsa-miR-4644	PAR-CLIP	27292025
MIRT568865	hsa-miR-4644	PAR-CLIP	27292025
MIRT568864	hsa-miR-4730	PAR-CLIP	27292025
MIRT568864	hsa-miR-4730	PAR-CLIP	27292025
MIRT568864	hsa-miR-4730	PAR-CLIP	27292025
MIRT568864	hsa-miR-4730	PAR-CLIP	27292025
MIRT568876	hsa-miR-4739	PAR-CLIP	27292025
MIRT568876	hsa-miR-4739	PAR-CLIP	27292025
MIRT568876	hsa-miR-4739	PAR-CLIP	27292025
MIRT568876	hsa-miR-4739	PAR-CLIP	27292025
MIRT568877	hsa-miR-4756-5p	PAR-CLIP	27292025
MIRT568877	hsa-miR-4756-5p	PAR-CLIP	27292025
MIRT568877	hsa-miR-4756-5p	PAR-CLIP	27292025
MIRT568877	hsa-miR-4756-5p	PAR-CLIP	27292025
MIRT568872	hsa-miR-5739	PAR-CLIP	27292025
MIRT568872	hsa-miR-5739	PAR-CLIP	27292025
MIRT568872	hsa-miR-5739	PAR-CLIP	27292025
MIRT568872	hsa-miR-5739	PAR-CLIP	27292025
MIRT568873	hsa-miR-6754-5p	PAR-CLIP	27292025
MIRT568873	hsa-miR-6754-5p	PAR-CLIP	27292025
MIRT568873	hsa-miR-6754-5p	PAR-CLIP	27292025
MIRT568873	hsa-miR-6754-5p	PAR-CLIP	27292025
MIRT568879	hsa-miR-4524b-3p	PAR-CLIP	20371350
MIRT568878	hsa-miR-1321	PAR-CLIP	20371350
MIRT568876	hsa-miR-4739	PAR-CLIP	20371350
MIRT568877	hsa-miR-4756-5p	PAR-CLIP	20371350
MIRT568875	hsa-miR-4270	PAR-CLIP	20371350
MIRT568874	hsa-miR-4441	PAR-CLIP	20371350
MIRT568873	hsa-miR-6754-5p	PAR-CLIP	20371350
MIRT568872	hsa-miR-5739	PAR-CLIP	20371350
MIRT568871	hsa-miR-4524a-3p	PAR-CLIP	20371350
MIRT568870	hsa-miR-4487	PAR-CLIP	20371350
MIRT568869	hsa-miR-3188	PAR-CLIP	20371350
MIRT568868	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT568867	hsa-miR-4306	PAR-CLIP	20371350
MIRT568865	hsa-miR-4644	PAR-CLIP	20371350
MIRT568866	hsa-miR-25-5p	PAR-CLIP	20371350
MIRT568864	hsa-miR-4730	PAR-CLIP	20371350
MIRT1122891	hsa-miR-1470	CLIP-seq
MIRT1122892	hsa-miR-3977	CLIP-seq
MIRT1122893	hsa-miR-4497	CLIP-seq
MIRT1122891	hsa-miR-1470	CLIP-seq
MIRT1122892	hsa-miR-3977	CLIP-seq
MIRT1122893	hsa-miR-4497	CLIP-seq
MIRT1122891	hsa-miR-1470	CLIP-seq
MIRT1122892	hsa-miR-3977	CLIP-seq
MIRT1122893	hsa-miR-4497	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007399	Process	Nervous system development	TAS	9799603
GO:0009887	Process	Animal organ morphogenesis	TAS	9799603
GO:0016020	Component	Membrane	IEA
GO:0030550	Function	Acetylcholine receptor inhibitor activity	IBA
GO:0033130	Function	Acetylcholine receptor binding	IBA
GO:0045202	Component	Synapse	IEA
GO:0095500	Process	Acetylcholine receptor signaling pathway	IBA
GO:0098552	Component	Side of membrane	IEA

MIM	HGNC	e!Ensembl
603625	6728	ENSG00000176956

O94772

Protein name

Lymphocyte antigen 6H (Ly-6H)

Protein function

Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inh

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00021	UPAR_LY6	28 → 111	u-PAR/Ly-6 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain (cerebral cortex, amygdala, hippocampus and subthalamic nucleus) and in acute human leukemic cell line MOLT-3. Also found in lower levels in testis, pancreas, small intestine and colon.

Sequence

MLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDP
SSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSP
WALAGGLLLSLGPALLWAGP

Sequence length

140

Interactions

View interactions

	Reactome
			Post-translational modification: synthesis of GPI-anchored proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CEREBRAL ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Stimulate	26862846	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	26862846	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Infections	Associate	26862846	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	35794137	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Stimulate	26862846	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	26862846, 35794137	★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndrome	Stimulate	26862846	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Associate	26862846	★★★★★ ★☆☆☆☆ Found in Text Mining only

LY6H (lymphocyte antigen 6 family member H)