Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4061
Gene name Gene Name - the full gene name approved by the HGNC.
Lymphocyte antigen 6 family member E
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LY6E
Synonyms (NCBI Gene) Gene synonyms aliases
RIG-E, RIGE, SCA-2, SCA2, TSA-1
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT037658 hsa-miR-744-5p CLASH 23622248
MIRT036974 hsa-miR-877-3p CLASH 23622248
MIRT452390 hsa-miR-6732-5p PAR-CLIP 23446348
MIRT452389 hsa-miR-6798-5p PAR-CLIP 23446348
MIRT452388 hsa-miR-6132 PAR-CLIP 23446348
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 36217029
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601384 6727 ENSG00000160932
Protein
UniProt ID Q16553
Protein name Lymphocyte antigen 6E (Ly-6E) (Retinoic acid-induced gene E protein) (RIG-E) (Stem cell antigen 2) (SCA-2) (Thymic shared antigen 1) (TSA-1)
Protein function GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00021 UPAR_LY6 23 99 u-PAR/Ly-6 domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, predominantly in liver, kidney, ovary, spleen and peripheral blood Leukocytes.
Sequence
MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNL
VTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCN
FSAADGGLRASVTLLGAGLLL
SLLPALLRFGP
Sequence length 131
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypertension Hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34108016
Autism Spectrum Disorder Associate 36077244
Breast Neoplasms Stimulate 26862846, 38114778
Carcinogenesis Associate 26862846
Carcinoma Hepatocellular Associate 37259059
Central Nervous System Infections Associate 26862846
Colorectal Neoplasms Stimulate 35310607
Coronavirus Infections Associate 32641482
Coronavirus Infections Inhibit 36128656
COVID 19 Inhibit 32641482