Gene Gene information from NCBI Gene database.
Entrez ID 4061
Gene name Lymphocyte antigen 6 family member E
Gene symbol LY6E
Synonyms (NCBI Gene)
RIG-ERIGESCA-2SCA2TSA-1
Chromosome 8
Chromosome location 8q24.3
miRNA miRNA information provided by mirtarbase database.
751
miRTarBase ID miRNA Experiments Reference
MIRT037658 hsa-miR-744-5p CLASH 23622248
MIRT036974 hsa-miR-877-3p CLASH 23622248
MIRT452390 hsa-miR-6732-5p PAR-CLIP 23446348
MIRT452389 hsa-miR-6798-5p PAR-CLIP 23446348
MIRT452388 hsa-miR-6132 PAR-CLIP 23446348
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 36217029
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601384 6727 ENSG00000160932
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16553
Protein name Lymphocyte antigen 6E (Ly-6E) (Retinoic acid-induced gene E protein) (RIG-E) (Stem cell antigen 2) (SCA-2) (Thymic shared antigen 1) (TSA-1)
Protein function GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00021 UPAR_LY6 23 99 u-PAR/Ly-6 domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed, predominantly in liver, kidney, ovary, spleen and peripheral blood Leukocytes.
Sequence
MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNL
VTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCN
FSAADGGLRASVTLLGAGLLL
SLLPALLRFGP
Sequence length 131
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins