Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4057
Gene name Gene Name - the full gene name approved by the HGNC.	Lactotransferrin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LTF
Synonyms (NCBI Gene) Gene synonyms aliases	GIG12, HEL110, HLF2, LF
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the transferrin family of genes and its protein product is found in the secondary granules of neutrophils. The protein is a major iron-binding protein in milk and body secretions with an antimicrobial activity, making it an import

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437811	hsa-miR-214-3p	Luciferase reporter assay	23479198
MIRT437811	hsa-miR-214-3p	Luciferase reporter assay	23479198
MIRT650642	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT650641	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT650640	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT650639	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT650638	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT650637	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT650635	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT650636	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT650634	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT650633	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT650632	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650631	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT650630	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650629	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT650628	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT650627	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650626	hsa-miR-3664-5p	HITS-CLIP	23824327
MIRT650642	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT650641	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT650640	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT650639	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT650638	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT650637	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT650635	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT650636	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT650634	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT650633	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT650632	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT650631	hsa-miR-3191-5p	HITS-CLIP	23824327
MIRT650630	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT650629	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT650628	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT650627	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650626	hsa-miR-3664-5p	HITS-CLIP	23824327

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CEBPE	Unknown	12522000
SP1	Unknown	10845904

Show/Hide all(64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001503	Process	Ossification	IEA
GO:0001530	Function	Lipopolysaccharide binding	IMP	15155221
GO:0001817	Process	Regulation of cytokine production	IDA	20345905
GO:0001895	Process	Retina homeostasis	HEP	23580065
GO:0002227	Process	Innate immune response in mucosa	IDA	12037568
GO:0003677	Function	DNA binding	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IDA	12788072
GO:0005506	Function	Iron ion binding	IDA	12037568
GO:0005515	Function	Protein binding	IPI	1544444, 9223490, 12522210, 17567961, 25193851, 27616280
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	12788072, 17567961, 18714013
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IMP	25193851
GO:0005769	Component	Early endosome	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006508	Process	Proteolysis	IEA
GO:0006826	Process	Iron ion transport	IBA	21873635
GO:0006959	Process	Humoral immune response	TAS	9770539
GO:0008201	Function	Heparin binding	IDA	11907569
GO:0009986	Component	Cell surface	IDA	17567961
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0019731	Process	Antibacterial humoral response	IBA	21873635
GO:0019731	Process	Antibacterial humoral response	IDA	1599934, 18714013
GO:0019732	Process	Antifungal humoral response	IDA	11083624
GO:0030141	Component	Secretory granule	IDA	11907569
GO:0031640	Process	Killing of cells of other organism	IDA	9727055
GO:0031640	Process	Killing of cells of other organism	IMP	15155221
GO:0031665	Process	Negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	20345905
GO:0032680	Process	Regulation of tumor necrosis factor production	IDA	20345905
GO:0032780	Process	Negative regulation of ATPase activity	IMP	25193851
GO:0032991	Component	Protein-containing complex	IDA	17567961
GO:0033214	Process	Siderophore-dependent iron import into cell	TAS
GO:0033690	Process	Positive regulation of osteoblast proliferation	IDA	15166119
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IMP	20345905
GO:0035580	Component	Specific granule lumen	TAS
GO:0042581	Component	Specific granule	IDA	2981589
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	20345905
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	20345905
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0044793	Process	Negative regulation by host of viral process	IMP	12522210
GO:0045071	Process	Negative regulation of viral genome replication	IMP	25193851
GO:0045669	Process	Positive regulation of osteoblast differentiation	IDA	15166119
GO:0048525	Process	Negative regulation of viral process	IMP	25193851
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	15155221
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	20345905
GO:0051673	Process	Membrane disruption in other organism	IMP	15155221
GO:0055037	Component	Recycling endosome	IBA	21873635
GO:0060349	Process	Bone morphogenesis	IDA	15166119
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IMP	15155221
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	20345905
GO:0097013	Component	Phagocytic vesicle lumen	TAS
GO:1900159	Process	Positive regulation of bone mineralization involved in bone maturation	ISS
GO:1900229	Process	Negative regulation of single-species biofilm formation in or on host organism	IDA	12037568
GO:1902732	Process	Positive regulation of chondrocyte proliferation	IDA	15166119
GO:1904724	Component	Tertiary granule lumen	TAS
GO:2000117	Process	Negative regulation of cysteine-type endopeptidase activity	IDA	12788072
GO:2000308	Process	Negative regulation of tumor necrosis factor (ligand) superfamily member 11 production	ISS
GO:2001205	Process	Negative regulation of osteoclast development	ISS

MIM	HGNC	e!Ensembl
150210	6720	ENSG00000012223

Protein

UniProt ID

P02788

Protein name

Lactotransferrin (Lactoferrin) (EC 3.4.21.-) (Growth-inhibiting protein 12) (Talalactoferrin) [Cleaved into: Lactoferricin-H (Lfcin-H); Kaliocin-1; Lactoferroxin-A; Lactoferroxin-B; Lactoferroxin-C]

Protein function

Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. ; [Lactotransferrin]: Major iron-binding and multifunctiona

PDB

1B0L , 1BKA , 1CB6 , 1DSN , 1EH3 , 1FCK , 1H43 , 1H44 , 1H45 , 1HSE , 1L5T , 1LCF , 1LCT , 1LFG , 1LFH , 1LFI , 1LGB , 1N76 , 1SQY , 1U62 , 1VFD , 1VFE , 1XV4 , 1XV7 , 1Z6V , 1Z6W , 2BJJ , 2DP4 , 2GMC , 2GMD , 2HD4 , 2PMS , 7JRD , 7N88

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00405	Transferrin	25 → 352	Transferrin	Domain
PF00405	Transferrin	364 → 695	Transferrin	Domain

Tissue specificity

TISSUE SPECIFICITY: High levels are found in saliva and tears, intermediate levels in serum and plasma, and low levels in urine. In kidney, detected in the distal collecting tubules in the medulla but not in the cortical region or in blood vessels. Detect

Sequence

MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDS
PIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKG
GSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGA
DKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDE
AERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKD
KSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAAR
RARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT
AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHT
AVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNS
NERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRK
PVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNL
LFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK

Sequence length

710

Interactions

View interactions

	Reactome
			Mtb iron assimilation by chelation Neutrophil degranulation Metal sequestration by antimicrobial proteins Antimicrobial peptides Amyloid fiber formation

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	12079509
Hypertension	Hypertensive disease	rs13306026	24587916
Osteoporosis	Osteoporosis, Age-Related, Osteoporosis, Osteoporosis, Senile, Post-Traumatic Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287	16936800, 16648989

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Endometriosis	Endometriosis	21063030	ClinVar
Myocardial Infarction	Myocardial Infarction		GWAS

Show/Hide Text Mining Associations (79)

Disease Name	Relationship Type	References
Associations from Text Mining
Altitude Sickness	Associate	37841248
Alzheimer Disease	Stimulate	19348738
Anemia Aplastic	Associate	35571618
Arthritis Rheumatoid	Stimulate	29410669
Asthma	Associate	33878997
Atrophy	Associate	34928497
Barrett Esophagus	Associate	35654816
Bronchiolitis Obliterans Syndrome	Associate	22806177
Cap Myopathy	Inhibit	17568188
Carcinoma Squamous Cell	Associate	37056929
Chronic Disease	Associate	36677706
Chronic Periodontitis	Associate	28485077
Colitis Ulcerative	Associate	25993694
COVID 19	Associate	38115996
Dental Caries	Associate	20485928, 25531160
Diabetes Mellitus	Associate	32075680
Diabetic Nephropathies	Associate	36092962, 36401196, 37986381
Dry Eye Syndromes	Associate	36677706
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	25531160
Endometrial Neoplasms	Associate	29693365
Eye Diseases	Associate	36490268
Fibrocartilaginous embolism	Associate	35613904
Fibrosis	Associate	38027143
Glaucoma Open Angle	Inhibit	37108298
Glioma	Associate	36153549
Guillain Barre Syndrome	Associate	38115996
Hashimoto Disease	Associate	34522174
Hearing Loss	Associate	34758154
HIV Infections	Associate	25946246
Hypertension	Stimulate	29774543
Hypertension	Associate	29774543
Idiopathic Pulmonary Fibrosis	Associate	21309737
Infections	Inhibit	15716060
Inflammation	Associate	19348738, 24571258, 25993694, 36293206
Inflammation	Inhibit	24571258
Inflammatory Bowel Diseases	Associate	30689765
Intervertebral Disc Degeneration	Associate	35613904
Intervertebral disc disease	Associate	35613904
Intestinal Diseases	Associate	22944598
Keratoconus	Associate	23727491, 36293206
Kidney Calculi	Associate	23874695
Leukemia Myeloid Acute	Associate	36212177
Lupus Erythematosus Systemic	Associate	40025620
Lymphatic Metastasis	Associate	25286756
Metabolic Syndrome	Associate	32957486
Mucopolysaccharidosis IV	Associate	33379360
Multiple Organ Failure	Associate	37533854
Nasal Polyps	Associate	23709377, 33506054
Nasopharyngeal Carcinoma	Associate	19129950, 33564686
Nasopharyngeal Carcinoma	Inhibit	25286756
Neoplasm Metastasis	Associate	31499027
Neoplasms	Inhibit	17568188, 31499027
Neoplasms	Associate	22944598, 29693365, 31195594, 37252795
Neurodegenerative Diseases	Associate	32786404
Neurofibromatosis 2	Associate	32366326
Niemann Pick Disease Type C	Associate	35613904, 36597889
Noncommunicable Diseases	Associate	36254061
Obesity	Stimulate	25394788
Obesity	Associate	32075680
Obesity Metabolically Benign	Associate	32957486
Osteoarthritis	Associate	32925767
Ovarian Neoplasms	Associate	21937479
Overweight	Stimulate	25394788
Parkinson Disease	Stimulate	32786404
Periodontitis	Associate	28485077
Periprosthetic Fractures	Associate	35306116
Pneumonia Ventilator Associated	Associate	23505561, 26218802, 26459786
Pre Eclampsia	Associate	37949031
Primary Myelofibrosis	Associate	33686952
Prostatic Intraepithelial Neoplasia	Associate	31499027
Prostatic Neoplasms	Inhibit	17568188, 31499027
Prostatitis	Associate	31499027
Pyelonephritis	Stimulate	27352120
Severe Acute Respiratory Syndrome	Associate	37949031, 39661012
Sjogren's Syndrome	Associate	34045583
Squamous Cell Carcinoma of Head and Neck	Associate	36360322
Thyroid Cancer Papillary	Associate	34522174
Thyroid Cancer Papillary	Stimulate	37457741
Tuberculosis	Associate	24885723

LTF (lactotransferrin)