Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4056
Gene name Gene Name - the full gene name approved by the HGNC.	Leukotriene C4 synthase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LTC4S
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q35.3
Summary Summary of gene provided in NCBI Entrez Gene.	The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the bi

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs730012	A>C,T	Drug-response	Upstream transcript variant

Show/Hide all(4)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016938	hsa-miR-335-5p	Microarray	18185580
MIRT1122211	hsa-miR-339-3p	CLIP-seq
MIRT1122212	hsa-miR-4707-5p	CLIP-seq
MIRT1122213	hsa-miR-4749-3p	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
KLF6	Unknown	10722737
NFKB1	Repression	12574384
RELA	Repression	12574384
SP1	Unknown	10722737;10919991
SP3	Unknown	10919991

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004464	Function	Leukotriene-C4 synthase activity	IBA
GO:0004464	Function	Leukotriene-C4 synthase activity	IDA	8706658, 9153254
GO:0004464	Function	Leukotriene-C4 synthase activity	IEA
GO:0004464	Function	Leukotriene-C4 synthase activity	TAS	8052639
GO:0004602	Function	Glutathione peroxidase activity	IBA
GO:0005515	Function	Protein binding	IPI	19233132, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IBA
GO:0005635	Component	Nuclear envelope	IDA	7599836, 19233132
GO:0005635	Component	Nuclear envelope	TAS
GO:0005640	Component	Nuclear outer membrane	IDA	12023288
GO:0005640	Component	Nuclear outer membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	19233132
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	12023288
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	IDA	8706658
GO:0006691	Process	Leukotriene metabolic process	IDA	9153254
GO:0006691	Process	Leukotriene metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	IEA
GO:0008047	Function	Enzyme activator activity	IEA
GO:0008289	Function	Lipid binding	IDA	8706658
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8052639
GO:0016740	Function	Transferase activity	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0019370	Process	Leukotriene biosynthetic process	IBA
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0031965	Component	Nuclear membrane	IDA	12023288
GO:0031965	Component	Nuclear membrane	IEA
GO:0042759	Process	Long-chain fatty acid biosynthetic process	IDA	27791009
GO:0042802	Function	Identical protein binding	IPI	15530365, 17632546, 17632548
GO:0043231	Component	Intracellular membrane-bounded organelle	TAS	1454853
GO:0046394	Process	Carboxylic acid biosynthetic process	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
246530	6719	ENSG00000213316

Protein

UniProt ID

Q16873

Protein name

Leukotriene C4 synthase (LTC4 synthase) (EC 4.4.1.20) (Glutathione S-transferase LTC4) (EC 2.5.1.-) (Leukotriene-C(4) synthase) (Leukotriene-C4 synthase)

Protein function

Catalyzes the conjugation of leukotriene A4 with reduced glutathione (GSH) to form leukotriene C4 with high specificity (PubMed:23409838, PubMed:27365393, PubMed:27791009, PubMed:7937884, PubMed:9153254). Can also catalyze the transfer of a glut

PDB

2PNO , 2UUH , 2UUI , 3B29 , 3HKK , 3LEO , 3PCV , 4BPM , 4J7T , 4J7Y , 4JC7 , 4JCZ , 4JRZ , 4WAB , 5HV9 , 6R7D , 9G0U , 9G0V , 9G14 , 9G1T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01124	MAPEG	8 → 131	MAPEG family	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in lung, platelets and the myelogenous leukemia cell line KG-1 (at protein level). LTC4S activity is present in eosinophils, basophils, mast cells, certain phagocytic mononuclear cells, endothelial cells, vascular smooth muscl

Sequence

MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA

Sequence length

150

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Metabolic pathways		Synthesis of 5-eicosatetraenoic acids Synthesis of Leukotrienes (LT) and Eoxins (EX) Synthesis of Lipoxins (LX) Biosynthesis of maresin conjugates in tissue regeneration (MCTR) Biosynthesis of protectin and resolvin conjugates in tissue regeneration (PCTR and RCTR)

LTC4S (leukotriene C4 synthase)