Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
405
Gene name Gene Name - the full gene name approved by the HGNC.
Aryl hydrocarbon receptor nuclear translocator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARNT
Synonyms (NCBI Gene) Gene synonyms aliases
ARNT1, HIF-1-beta, HIF-1beta, HIF1-beta, HIF1B, HIF1BETA, TANGO, bHLHe2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus,
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004537 hsa-miR-107 qRT-PCR, Luciferase reporter assay, Western blot, Northern blot 20308559
MIRT004537 hsa-miR-107 qRT-PCR, Luciferase reporter assay, Western blot, Northern blot 20308559
MIRT004537 hsa-miR-107 Reporter assay;Western blot 20308559
MIRT043236 hsa-miR-324-5p CLASH 23622248
MIRT037117 hsa-miR-877-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
AHR Unknown 19255421;8631989
HIF1A Unknown 12239177
PHB2 Repression 21256954
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IDA 7539918, 8756616
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IDA 23275542
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
126110 700 ENSG00000143437
Protein
UniProt ID P27540
Protein name Aryl hydrocarbon receptor nuclear translocator (ARNT protein) (Class E basic helix-loop-helix protein 2) (bHLHe2) (Dioxin receptor, nuclear translocator) (Hypoxia-inducible factor 1-beta) (HIF-1-beta) (HIF1-beta)
Protein function Required for activity of the AHR. Upon ligand binding, AHR translocates into the nucleus, where it heterodimerizes with ARNT and induces transcription by binding to xenobiotic response elements (XRE). Not required for the ligand-binding subunit
PDB 1X0O , 2A24 , 2B02 , 2HV1 , 2K7S , 3F1N , 3F1O , 3F1P , 3H7W , 3H82 , 4EQ1 , 4GHI , 4GS9 , 4H6J , 4LPZ , 4PKY , 4XT2 , 5TBM , 5UFP , 5V0L , 6CZW , 6D09 , 6D0B , 6D0C , 6X21 , 6X28 , 6X2H , 6X37 , 6X3D , 8CK3 , 8CK4 , 8CK8 , 8G4A , 8XS6 , 8XS7 , 8XS8 , 8XS9 , 8XSA , 8XSB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 90 143 Helix-loop-helix DNA-binding domain Domain
PF00989 PAS 163 270 PAS fold Domain
PF14598 PAS_11 360 469 Domain
Sequence
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLR
GTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCG
SSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQ
EPRPTLSNTIQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKT
RTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPD
LTMFPPFSE
Sequence length 789
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  HIF-1 signaling pathway
Efferocytosis
Cushing syndrome
Pathways in cancer
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Renal cell carcinoma
  Regulation of gene expression by Hypoxia-inducible Factor
PPARA activates gene expression
Phase I - Functionalization of compounds
Endogenous sterols
Xenobiotics
Aryl hydrocarbon receptor signalling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
21081473
Colorectal neoplasms Colorectal Neoplasms rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
21081473
Lymphoblastic leukemia Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699
View all (13 more)
22674224
Melanoma melanoma, Cutaneous Melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)
21983785, 30429480
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 22138541 ClinVar
Malignant melanoma of skin Malignant melanoma of skin of lower limb, Malignant melanoma of skin of upper limb 30429480 ClinVar
Metabolic Syndrome Metabolic Syndrome GWAS
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Inhibit 26838552
Arthritis Rheumatoid Associate 35309329
Autoimmune Diseases Associate 31759816
Breast Neoplasms Associate 16567799, 24081025, 26046764
Carcinogenesis Associate 19203995, 22306343
Carcinoma Hepatocellular Associate 25068796, 34258170
Carcinoma Renal Cell Associate 24916699, 29022645
Carcinoma Squamous Cell Associate 19203995
Cardiomyopathy Restrictive Associate 25343232
CD59 Deficiency Associate 31759816