LTA4H (leukotriene A4 hydrolase)

Gene

• Entrez ID: 4048
• Gene name: Leukotriene A4 hydrolase
• Gene symbol: LTA4H
• Synonyms (NCBI Gene): -
• Chromosome: 12
• Chromosome location: 12q23.1
• Summary: The protein encoded by this gene is an enzyme that contains both hydrolase and aminopeptidase activities. The hydrolase activity is used in the final step of the biosynthesis of leukotriene B4, a proinflammatory mediator. The aminopeptidase activity has b

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023123	hsa-miR-124-3p	Microarray	18668037
MIRT030208	hsa-miR-26b-5p	Microarray	19088304
MIRT052512	hsa-let-7a-5p	CLASH	23622248
MIRT052143	hsa-let-7b-5p	CLASH	23622248
MIRT051821	hsa-let-7c-5p	CLASH	23622248
MIRT045983	hsa-miR-125b-5p	CLASH	23622248
MIRT2034493	hsa-miR-4670-3p	CLIP-seq
MIRT2563971	hsa-miR-216b	CLIP-seq
MIRT2563972	hsa-miR-3675-3p	CLIP-seq
MIRT2563973	hsa-miR-4311	CLIP-seq
MIRT2563974	hsa-miR-4668-3p	CLIP-seq
MIRT2563975	hsa-miR-539	CLIP-seq
MIRT2563971	hsa-miR-216b	CLIP-seq
MIRT2563972	hsa-miR-3675-3p	CLIP-seq
MIRT2563973	hsa-miR-4311	CLIP-seq
MIRT2563974	hsa-miR-4668-3p	CLIP-seq
MIRT2563975	hsa-miR-539	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004177	Function	Aminopeptidase activity	IBA
GO:0004177	Function	Aminopeptidase activity	IDA	9774412, 15078870, 18804029
GO:0004177	Function	Aminopeptidase activity	IEA
GO:0004301	Function	Epoxide hydrolase activity	IBA
GO:0004301	Function	Epoxide hydrolase activity	IDA	15078870
GO:0004301	Function	Epoxide hydrolase activity	IMP	11675384
GO:0004301	Function	Epoxide hydrolase activity	TAS	11154734
GO:0004463	Function	Leukotriene-A4 hydrolase activity	IBA
GO:0004463	Function	Leukotriene-A4 hydrolase activity	IDA	9774412, 15078870
GO:0004463	Function	Leukotriene-A4 hydrolase activity	IEA
GO:0004463	Function	Leukotriene-A4 hydrolase activity	TAS	1881903
GO:0005515	Function	Protein binding	IPI	21044950
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006691	Process	Leukotriene metabolic process	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	TAS	1881903
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IDA	15078870, 18804029
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	IMP	11675384
GO:0008270	Function	Zinc ion binding	TAS	1881903
GO:0010043	Process	Response to zinc ion	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019370	Process	Leukotriene biosynthetic process	IBA
GO:0019370	Process	Leukotriene biosynthetic process	IDA	9774412, 15078870
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0019370	Process	Leukotriene biosynthetic process	IMP	11675384
GO:0019370	Process	Leukotriene biosynthetic process	TAS	1881903
GO:0019538	Process	Protein metabolic process	IMP	11675384
GO:0043171	Process	Peptide catabolic process	IBA
GO:0043171	Process	Peptide catabolic process	IDA	9774412, 15078870, 18804029
GO:0043434	Process	Response to peptide hormone	IEA
GO:0045148	Function	Tripeptide aminopeptidase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060509	Process	Type I pneumocyte differentiation	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IMP	11675384
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 151570
• HGNC: 6710
• e!Ensembl: ENSG00000111144

Protein

• UniProt ID: P09960
• Protein name: Leukotriene A-4 hydrolase (LTA-4 hydrolase) (EC 3.3.2.6) (Leukotriene A(4) hydrolase) (Tripeptide aminopeptidase LTA4H) (EC 3.4.11.4)
• Protein function: Bifunctional zinc metalloenzyme that comprises both epoxide hydrolase (EH) and aminopeptidase activities. Acts as an epoxide hydrolase to catalyze the conversion of LTA4 to the pro-inflammatory mediator leukotriene B4 (LTB4) (PubMed:11917124, Pu
• PDB: 1GW6, 1H19, 1HS6, 1SQM, 2R59, 2VJ8, 3B7R, 3B7S, 3B7T, 3B7U, 3CHO, 3CHP, 3CHQ, 3CHR, 3CHS, 3FH5, 3FH7, 3FH8, 3FHE, 3FTS, 3FTU, 3FTV, 3FTW, 3FTX, 3FTY, 3FTZ, 3FU0, 3FU3, 3FU5, 3FU6, 3FUD, 3FUE, 3FUF, 3FUH, 3FUI, 3FUJ, 3FUK, 3FUL, 3FUM, 3FUN, 3U9W, 4DPR, 4L2L, 4MKT, 4MS6, 4R7L, 4RSY, 4RVB, 5AEN, 5BPP, 5FWQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17900	Peptidase_M1_N	18 → 202		Domain
  PF01433	Peptidase_M1	233 → 448	Peptidase family M1 domain	Domain
  PF09127	Leuk-A4-hydro_C	495 → 608	Leukotriene A4 hydrolase, C-terminal	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in monocytes, lymphocytes, neutrophils, reticulocytes, platelets and fibroblasts.
• Sequence:

  MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDL
  TIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
  PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETP
  DPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
  MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
  SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGET
  HPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI
  TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
  EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
  RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
  AMLVGKDLKVD

• Sequence length: 611

Pathways

KEGG:

Arachidonic acid metabolism
Metabolic pathways

Reactome:

Synthesis of Leukotrienes (LT) and Eoxins (EX)
Neutrophil degranulation
Biosynthesis of D-series resolvins
Biosynthesis of protectins
Biosynthesis of E-series 18(S)-resolvins
Biosynthesis of aspirin-triggered D-series resolvins
Biosynthesis of E-series 18(R)-resolvins