Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4048
Gene name Gene Name - the full gene name approved by the HGNC.	Leukotriene A4 hydrolase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LTA4H
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q23.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an enzyme that contains both hydrolase and aminopeptidase activities. The hydrolase activity is used in the final step of the biosynthesis of leukotriene B4, a proinflammatory mediator. The aminopeptidase activity has b

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023123	hsa-miR-124-3p	Microarray	18668037
MIRT030208	hsa-miR-26b-5p	Microarray	19088304
MIRT052512	hsa-let-7a-5p	CLASH	23622248
MIRT052143	hsa-let-7b-5p	CLASH	23622248
MIRT051821	hsa-let-7c-5p	CLASH	23622248
MIRT045983	hsa-miR-125b-5p	CLASH	23622248
MIRT2034493	hsa-miR-4670-3p	CLIP-seq
MIRT2563971	hsa-miR-216b	CLIP-seq
MIRT2563972	hsa-miR-3675-3p	CLIP-seq
MIRT2563973	hsa-miR-4311	CLIP-seq
MIRT2563974	hsa-miR-4668-3p	CLIP-seq
MIRT2563975	hsa-miR-539	CLIP-seq
MIRT2563971	hsa-miR-216b	CLIP-seq
MIRT2563972	hsa-miR-3675-3p	CLIP-seq
MIRT2563973	hsa-miR-4311	CLIP-seq
MIRT2563974	hsa-miR-4668-3p	CLIP-seq
MIRT2563975	hsa-miR-539	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004177	Function	Aminopeptidase activity	IBA	21873635
GO:0004177	Function	Aminopeptidase activity	IDA	9774412, 15078870, 18804029
GO:0004301	Function	Epoxide hydrolase activity	IBA	21873635
GO:0004301	Function	Epoxide hydrolase activity	IDA	15078870
GO:0004301	Function	Epoxide hydrolase activity	IMP	11675384
GO:0004301	Function	Epoxide hydrolase activity	TAS	11154734
GO:0004463	Function	Leukotriene-A4 hydrolase activity	IBA	21873635
GO:0004463	Function	Leukotriene-A4 hydrolase activity	IDA	9774412, 15078870
GO:0005515	Function	Protein binding	IPI	21044950
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0006691	Process	Leukotriene metabolic process	TAS
GO:0008233	Function	Peptidase activity	TAS	1881903
GO:0008270	Function	Zinc ion binding	IDA	15078870, 18804029
GO:0008270	Function	Zinc ion binding	IMP	11675384
GO:0019370	Process	Leukotriene biosynthetic process	IBA	21873635
GO:0019370	Process	Leukotriene biosynthetic process	IDA	9774412, 15078870
GO:0019370	Process	Leukotriene biosynthetic process	IMP	11675384
GO:0042759	Process	Long-chain fatty acid biosynthetic process	TAS
GO:0043171	Process	Peptide catabolic process	IBA	21873635
GO:0043171	Process	Peptide catabolic process	IDA	9774412, 15078870, 18804029
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0044267	Process	Cellular protein metabolic process	IMP	11675384
GO:0045148	Function	Tripeptide aminopeptidase activity	IEA
GO:0070006	Function	Metalloaminopeptidase activity	IMP	11675384
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
151570	6710	ENSG00000111144

Protein

UniProt ID

P09960

Protein name

Leukotriene A-4 hydrolase (LTA-4 hydrolase) (EC 3.3.2.6) (Leukotriene A(4) hydrolase) (Tripeptide aminopeptidase LTA4H) (EC 3.4.11.4)

Protein function

Bifunctional zinc metalloenzyme that comprises both epoxide hydrolase (EH) and aminopeptidase activities. Acts as an epoxide hydrolase to catalyze the conversion of LTA4 to the pro-inflammatory mediator leukotriene B4 (LTB4) (PubMed:11917124, Pu

PDB

1GW6 , 1H19 , 1HS6 , 1SQM , 2R59 , 2VJ8 , 3B7R , 3B7S , 3B7T , 3B7U , 3CHO , 3CHP , 3CHQ , 3CHR , 3CHS , 3FH5 , 3FH7 , 3FH8 , 3FHE , 3FTS , 3FTU , 3FTV , 3FTW , 3FTX , 3FTY , 3FTZ , 3FU0 , 3FU3 , 3FU5 , 3FU6 , 3FUD , 3FUE , 3FUF , 3FUH , 3FUI , 3FUJ , 3FUK , 3FUL , 3FUM , 3FUN , 3U9W , 4DPR , 4L2L , 4MKT , 4MS6 , 4R7L , 4RSY , 4RVB , 5AEN , 5BPP , 5FWQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17900	Peptidase_M1_N	18 → 202		Domain
PF01433	Peptidase_M1	233 → 448	Peptidase family M1 domain	Domain
PF09127	Leuk-A4-hydro_C	495 → 608	Leukotriene A4 hydrolase, C-terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in monocytes, lymphocytes, neutrophils, reticulocytes, platelets and fibroblasts.

Sequence

MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDL
TIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETP
DPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGET
HPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
AMLVGKDLKVD

Sequence length

611

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Metabolic pathways		Synthesis of Leukotrienes (LT) and Eoxins (EX) Neutrophil degranulation Biosynthesis of D-series resolvins Biosynthesis of protectins Biosynthesis of E-series 18(S)-resolvins Biosynthesis of aspirin-triggered D-series resolvins Biosynthesis of E-series 18(R)-resolvins

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Atherosclerosis	Atherosclerosis	16698924	ClinVar
Mental depression	Mental Depression, Depressive disorder	19622707	ClinVar

Show/Hide Text Mining Associations (37)

Disease Name	Relationship Type	References
Associations from Text Mining
Asthma	Associate	20067482, 22206291, 23167751, 23573270, 34550981
Atherosclerosis	Associate	19130089, 21293878, 23153620
Cardiovascular Diseases	Associate	19130089, 24366255
Coronary Artery Disease	Associate	19130089, 21293878, 24366255, 29067980
Coronary Disease	Associate	19130089
Crohn Disease	Associate	31093505
Depressive Disorder	Associate	19622707
Down Syndrome	Associate	27293319
Dyspnea	Associate	34694182
Embolism Paradoxical	Associate	36879040
Emphysema	Associate	34694182
Glioma	Associate	19919819
Glomerulonephritis Membranous	Associate	10337029
Glomerulosclerosis Focal Segmental	Associate	10337029
Graft vs Host Disease	Associate	15054046
HIV Infections	Associate	28419368
Immune Reconstitution Inflammatory Syndrome	Associate	27643598, 34390048
Inflammation	Associate	26959888, 27293319, 27643598, 28419368, 30678701, 33416499, 34694182
Iridogoniodysgenesis type1	Associate	27643598
Job Syndrome	Associate	33416499
Liposarcoma	Associate	21038090
Meningitis Bacterial	Associate	25799317
Meningitis Cryptococcal	Associate	34390048
Metabolic Syndrome	Associate	29067980
Myocardial Infarction	Associate	30678701
Neoplasm Metastasis	Associate	36923505
Neoplasms	Associate	26959888, 36923505
Nephrotic Syndrome	Associate	10337029
Neuroendocrine Tumors	Associate	37453564
Ovarian Neoplasms	Associate	38238671
Prostatic Neoplasms	Associate	21308720
Pulmonary Disease Chronic Obstructive	Associate	34694182
Squamous Cell Carcinoma of Head and Neck	Associate	36923505
Tuberculosis	Associate	27643598, 31093505
Tuberculosis Extrapulmonary	Associate	31093505, 36879040
Tuberculosis Lymph Node	Associate	36672948
Tuberculosis Meningeal	Associate	25799317, 28419368, 30169607, 33416499, 36879040

LTA4H (leukotriene A4 hydrolase)