Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4046
Gene name Gene Name - the full gene name approved by the HGNC.
Lymphocyte specific protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LSP1
Synonyms (NCBI Gene) Gene synonyms aliases
WP34, pp52
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Al
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018132 hsa-miR-335-5p Microarray 18185580
MIRT437982 hsa-miR-196a-5p Luciferase reporter assay 24681820
MIRT437982 hsa-miR-196a-5p Luciferase reporter assay 24681820
MIRT489821 hsa-miR-6858-3p PAR-CLIP 20371350
MIRT489819 hsa-miR-4676-5p PAR-CLIP 20371350
Transcription factors
Transcription factor Regulation Reference
SP1 Unknown 9257843
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0005886 Component Plasma membrane IEA
GO:0006968 Process Cellular defense response TAS 2174784
GO:0007165 Process Signal transduction IEA
GO:0015629 Component Actin cytoskeleton TAS 8274738
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
153432 6707 ENSG00000130592
Protein
UniProt ID P33241
Protein name Lymphocyte-specific protein 1 (47 kDa actin-binding protein) (52 kDa phosphoprotein) (pp52) (Lymphocyte-specific antigen WP34)
Protein function May play a role in mediating neutrophil activation and chemotaxis.
PDB 3BH8 , 4NO0 , 4NO2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02029 Caldesmon 159 317 Caldesmon Disordered
Tissue specificity TISSUE SPECIFICITY: Activated T-lymphocytes.
Sequence
MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPK
QEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRP
GLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLV
LEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIET
AGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQK
GGSKTSSTIKSTPSGKR
YKFVATGHGKYEKVLVEGGPAP
Sequence length 339
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  C-type lectin receptor signaling pathway
Tuberculosis
 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
17529967, 23535729, 20453838
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
29059683, 17529967, 25751625, 27117709, 23535729, 20453838
Hypertension Hypertensive disease rs13306026 30487518
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
20453838, 17529967
Unknown
Disease term Disease name Evidence References Source
Nasopharyngeal carcinoma Nasopharyngeal carcinoma These data suggest that KAT7 can contribute NPC cell growth and survival through up-regulation of NPC-essential genes. 20512145 ClinVar, CBGDA
Ulcerative colitis Ulcerative colitis GWAS
Inflammatory Bowel Disease Inflammatory Bowel Disease GWAS
Heart Failure Heart Failure GWAS
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 34691030
Breast Neoplasms Associate 17529967, 18437204, 18612136, 18973230, 19094228, 19656774, 20453838, 20484103, 20605201, 20699374, 21118973, 21194473, 21596841, 21791674, 22045194
View all (16 more)
Carcinoma Hepatocellular Associate 22326833, 29927686, 37889536
Carotid Body Tumor Associate 30967136
Colorectal Neoplasms Associate 32321427
Glioblastoma Associate 32003759
Glioma Associate 32003759
Hodgkin Disease Associate 10233704, 12588355
Inflammation Associate 22253938
Leukemia Associate 38511641