LSP1 (lymphocyte specific protein 1)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4046
Gene name Gene Name - the full gene name approved by the HGNC.
Lymphocyte specific protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LSP1
Synonyms (NCBI Gene) Gene synonyms aliases
WP34, pp52
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Al
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(78)
miRTarBase ID miRNA Experiments Reference
MIRT018132 hsa-miR-335-5p Microarray 18185580
MIRT437982 hsa-miR-196a-5p Luciferase reporter assay 24681820
MIRT437982 hsa-miR-196a-5p Luciferase reporter assay 24681820
MIRT489821 hsa-miR-6858-3p PAR-CLIP 20371350
MIRT489819 hsa-miR-4676-5p PAR-CLIP 20371350
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
SP1 Unknown 9257843
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0003779 Function Actin binding TAS 8274738
GO:0005515 Function Protein binding IPI 35156780
GO:0005886 Component Plasma membrane IEA
GO:0006935 Process Chemotaxis IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
153432 6707 ENSG00000130592
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P33241
Protein name Lymphocyte-specific protein 1 (47 kDa actin-binding protein) (52 kDa phosphoprotein) (pp52) (Lymphocyte-specific antigen WP34)
Protein function May play a role in mediating neutrophil activation and chemotaxis.
PDB 3BH8 , 4NO0 , 4NO2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02029 Caldesmon 159 → 317 Caldesmon Disordered
Tissue specificity TISSUE SPECIFICITY: Activated T-lymphocytes.
Sequence 
MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPK
QEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRP
GLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLV
LEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIET
AGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQK
GGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP
Sequence length 339
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  C-type lectin receptor signaling pathway
Tuberculosis 		 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (6)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Breast cancer Breast cancer (estrogen-receptor negative), Breast cancer N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Hypertension Hypertension, Hypertension (confirmatory factor analysis Factor 12), Hypertension (PheCode 401), Essential hypertension (PheCode 401.1), High blood pressure / hypertension N/A N/A GWAS
Show/Hide Text Mining Associations (30)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 34691030
Breast Neoplasms Associate 17529967, 18437204, 18612136, 18973230, 19094228, 19656774, 20453838, 20484103, 20605201, 20699374, 21118973, 21194473, 21596841, 21791674, 22045194
View all (16 more)
Carcinoma Hepatocellular Associate 22326833, 29927686, 37889536
Carotid Body Tumor Associate 30967136
Colorectal Neoplasms Associate 32321427
Glioblastoma Associate 32003759
Glioma Associate 32003759
Hodgkin Disease Associate 10233704, 12588355
Inflammation Associate 22253938
Leukemia Associate 38511641