Gene Gene information from NCBI Gene database.
Entrez ID 404281
Gene name YY2 transcription factor
Gene symbol YY2
Synonyms (NCBI Gene)
ZNF631
Chromosome X
Chromosome location Xp22.12
Summary The protein encoded by this gene is a transcription factor that includes several Kruppel-like zinc fingers in its C-terminal region. It possesses both activation and repression domains, and it can therefore have both positive and negative effects on the t
miRNA miRNA information provided by mirtarbase database.
170
miRTarBase ID miRNA Experiments Reference
MIRT643635 hsa-miR-29a-3p HITS-CLIP 23824327
MIRT643634 hsa-miR-29b-3p HITS-CLIP 23824327
MIRT643633 hsa-miR-29c-3p HITS-CLIP 23824327
MIRT643632 hsa-miR-3168 HITS-CLIP 23824327
MIRT643631 hsa-miR-148b-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IDA 16260628
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 15087442
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300570 31684 ENSG00000230797
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O15391
Protein name Transcription factor YY2 (Yin and yang 2) (YY-2) (Zinc finger protein 631)
Protein function Functions as a multifunctional transcription factor that may exhibit positive and negative control on a large number of genes. May antagonize YY1 and function in development and differentiation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 311 335 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 341 365 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in kidney, liver, spleen and testis but not in colon. {ECO:0000269|PubMed:15087442}.
Sequence
MASNEDFSITQDLEIPADIVELHDINVEPLPMEDIPTESVQYEDVDGNWIYGGHNHPPLM
VLQPLFTNTGYGDHDQEMLMLQTQEEVVGYCDSDNQLGNDLEDQLALPDSIEDEHFQMTL
ASLSASAASTSTSTQSRSKKPSKKPSGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTLE
GEFSVTMWSPNDNNDQGAVGEGQAENPPDYSEYLKGKKLPPGGLPGIDLSDPKQLAEFTK
VKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRR
HQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGDKPFVCPFDVCNRKFAQSTNLKT
HILTH
VKTKNNP
Sequence length 372
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  ATP-dependent chromatin remodeling
Polycomb repressive complex