Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4026
Gene name Gene Name - the full gene name approved by the HGNC.
LIM domain containing preferred translocation partner in lipoma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LPP
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q27.3-q28
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a subfamily of LIM domain proteins that are characterized by an N-terminal proline-rich region and three C-terminal LIM domains. The encoded protein localizes to the cell periphery in focal adhesions and may be involved in ce
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022848 hsa-miR-124-3p Microarray 18668037
MIRT237292 hsa-miR-142-3p Luciferase reporter assay 24361879
MIRT237292 hsa-miR-142-3p Luciferase reporter assay 24361879
MIRT237292 hsa-miR-142-3p Luciferase reporter assay 24361879
MIRT237292 hsa-miR-142-3p Luciferase reporter assay 24361879
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001725 Component Stress fiber IBA
GO:0005515 Function Protein binding IPI 15649318
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600700 6679 ENSG00000145012
Protein
UniProt ID Q93052
Protein name Lipoma-preferred partner (LIM domain-containing preferred translocation partner in lipoma)
Protein function May play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. May be involved in signal
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 416 473 LIM domain Domain
PF00412 LIM 476 532 LIM domain Domain
PF00412 LIM 536 600 LIM domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in a wide variety of tissues but no or very low expression in brain and peripheral leukocytes. {ECO:0000269|PubMed:10637295, ECO:0000269|PubMed:8812423}.
Sequence
MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQ
PGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAE
IDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKSTL
KPQPAPQAGPIPVAPIGTLKPQPQPVPASYTTASTSSRPTFNVQVKSAQPSPHYMAAPSS
GQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGY
YAAGPGYGGRNDSDPTYGQQGHPNTWKREPGYTPPGAGNQNPPGMYPVTGPKKTYITDPV
SAPCAPPLQPKGGHSGQLGPSSVAPSFRPEDELEHLTKKMLYDMENPPADEYFGRCARCG
ENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTL
EQCNVCS
KPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKF
APRCSVCK
EPIMPAPGQEETVRIVALDRDFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSAR

IRVLTAKASTDL
Sequence length 612
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Allergic Sensitization Allergic sensitization N/A N/A GWAS
Alopecia Areata Alopecia areata N/A N/A GWAS
Asthma Asthma onset (childhood vs adult), Asthma (childhood onset), Nonatopic asthma, Asthma (age of onset), Atopic asthma, Age of onset of adult onset asthma, Asthma in any disease, Pediatric asthma, Asthma N/A N/A GWAS
Carcinoma Squamous cell carcinoma, Basal cell carcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 23874428, 30621612
Arthritis Juvenile Associate 20647273
Atelosteogenesis type 2 Associate 16567472
Breast Neoplasms Associate 30597111
Celiac Disease Associate 19073967, 23152861, 24278174
Colorectal Neoplasms Associate 24673742
Congenital Abnormalities Associate 33084842
Diabetes Mellitus Type 1 Associate 19073967
Diabetes Mellitus Type 2 Associate 25799151
Endometrial Neoplasms Associate 36047377