Gene Gene information from NCBI Gene database.
Entrez ID 4026
Gene name LIM domain containing preferred translocation partner in lipoma
Gene symbol LPP
Synonyms (NCBI Gene)
-
Chromosome 3
Chromosome location 3q27.3-q28
Summary This gene encodes a member of a subfamily of LIM domain proteins that are characterized by an N-terminal proline-rich region and three C-terminal LIM domains. The encoded protein localizes to the cell periphery in focal adhesions and may be involved in ce
miRNA miRNA information provided by mirtarbase database.
2844
miRTarBase ID miRNA Experiments Reference
MIRT022848 hsa-miR-124-3p Microarray 18668037
MIRT237292 hsa-miR-142-3p Luciferase reporter assay 24361879
MIRT237292 hsa-miR-142-3p Luciferase reporter assay 24361879
MIRT237292 hsa-miR-142-3p Luciferase reporter assay 24361879
MIRT237292 hsa-miR-142-3p Luciferase reporter assay 24361879
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0001725 Component Stress fiber IBA
GO:0005515 Function Protein binding IPI 15649318
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600700 6679 ENSG00000145012
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q93052
Protein name Lipoma-preferred partner (LIM domain-containing preferred translocation partner in lipoma)
Protein function May play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. May be involved in signal
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 416 473 LIM domain Domain
PF00412 LIM 476 532 LIM domain Domain
PF00412 LIM 536 600 LIM domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in a wide variety of tissues but no or very low expression in brain and peripheral leukocytes. {ECO:0000269|PubMed:10637295, ECO:0000269|PubMed:8812423}.
Sequence
MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQ
PGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAE
IDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKSTL
KPQPAPQAGPIPVAPIGTLKPQPQPVPASYTTASTSSRPTFNVQVKSAQPSPHYMAAPSS
GQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGY
YAAGPGYGGRNDSDPTYGQQGHPNTWKREPGYTPPGAGNQNPPGMYPVTGPKKTYITDPV
SAPCAPPLQPKGGHSGQLGPSSVAPSFRPEDELEHLTKKMLYDMENPPADEYFGRCARCG
ENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTL
EQCNVCS
KPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKF
APRCSVCK
EPIMPAPGQEETVRIVALDRDFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSAR

IRVLTAKASTDL
Sequence length 612
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
34
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Conflicting classifications of pathogenicity; Uncertain significance; Benign; Likely benign rs202115941, rs201958080, rs6771786, rs9830664, rs35746269 RCV001329432
RCV005399195
RCV005908011
RCV005908428
RCV001294214
Clear cell carcinoma of kidney Likely benign rs9830664 RCV005908430
Colon adenocarcinoma Benign rs6771786 RCV005908010
Gastric cancer Benign rs6771786 RCV005908015
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 23874428, 30621612
Arthritis Juvenile Associate 20647273
Atelosteogenesis type 2 Associate 16567472
Breast Neoplasms Associate 30597111
Celiac Disease Associate 19073967, 23152861, 24278174
Colorectal Neoplasms Associate 24673742
Congenital Abnormalities Associate 33084842
Diabetes Mellitus Type 1 Associate 19073967
Diabetes Mellitus Type 2 Associate 25799151
Endometrial Neoplasms Associate 36047377