Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	4025
Gene name Gene Name - the full gene name approved by the HGNC.	Lactoperoxidase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LPO
Synonyms (NCBI Gene) Gene synonyms aliases	SPO
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q22
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the peroxidase family of proteins. The encoded preproprotein is proteolytically processed to generate the mature enzyme. Following its secretion from salivary, mammary, and other mucosal glands, this enzyme catalyzes the gene

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments
MIRT1116526	hsa-miR-3545-3p	CLIP-seq
MIRT1116527	hsa-miR-4475	CLIP-seq
MIRT1116528	hsa-miR-4521	CLIP-seq
MIRT1116529	hsa-miR-4704-3p	CLIP-seq
MIRT1116530	hsa-miR-616	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	24248522
GO:0004601	Function	Peroxidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	24248522
GO:0005737	Component	Cytoplasm	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	NAS	8964511
GO:0016323	Component	Basolateral plasma membrane	IDA	19059195
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0018969	Process	Thiocyanate metabolic process	IEA
GO:0020037	Function	Heme binding	IEA
GO:0036393	Function	Thiocyanate peroxidase activity	IBA
GO:0036393	Function	Thiocyanate peroxidase activity	IDA	12626341
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IDA	12626341
GO:0042744	Process	Hydrogen peroxide catabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:0140825	Function	Lactoperoxidase activity	IEA

MIM	HGNC	e!Ensembl
150205	6678	ENSG00000167419

Protein

UniProt ID

P22079

Protein name

Lactoperoxidase (LPO) (EC 1.11.1.7) (Salivary peroxidase) (SPO)

Protein function

Heme-containing oxidoreductase which catalyzes the conversion of thiocyanate (SCN(-)) into antimicrobial agent hypothiocyanous acid (OSCN(-)) in the presence of hydrogen peroxide (H2O2) (By similarity). Also involved in the conversion of iodide

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03098	An_peroxidase	138 → 684	Animal haem peroxidase	Domain

Tissue specificity

TISSUE SPECIFICITY: Mammary gland, milk and salivary gland. Found in bronchial submucosal glands. {ECO:0000269|PubMed:10715594, ECO:0000269|PubMed:12626341}.

Sequence

MRVLLHLPALLASLILLQAAASTTRAQTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAM
SSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLE
VGCGAPAPVVRCDPCSPYRTITGDCNNRRKPALGAANRALARWLPAEYEDGLSLPFGWTP
GKTRNGFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSE
YSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINAL
TSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTT
ARVPCFLAGDSRASEHILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAF
VQIITFRDYLPILLGDHMQKWIPPYQGYSESVDPRISNVFTFAFRFGHLEVPSSMFRLDE
NYQPWGPEPELPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMKQNKMMTGELRNKLFQ
PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGL
YGTPDNIDIWIGAIAEPLVERGRVGPLLACLLGKQFQQIRDGDRFWWENPGVFTNEQKDS
LQKMSFSRLVCDNTRITKVPRDPFWANSYPYDFVDCSAIDKLDLSPWASVKN

Sequence length

712

Interactions

View interactions

	KEGG		Reactome
	Salivary secretion Chemical carcinogenesis - reactive oxygen species		Events associated with phagocytolytic activity of PMN cells

LPO (lactoperoxidase)