VWC2L (von Willebrand factor C domain containing 2 like)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
402117
Gene name Gene Name - the full gene name approved by the HGNC.
Von Willebrand factor C domain containing 2 like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VWC2L
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q34-q35
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(184)
miRTarBase ID miRNA Experiments Reference
MIRT609779 hsa-miR-4464 HITS-CLIP 19536157
MIRT609778 hsa-miR-4748 HITS-CLIP 19536157
MIRT609777 hsa-miR-329-5p HITS-CLIP 19536157
MIRT609776 hsa-miR-1304-3p HITS-CLIP 19536157
MIRT609775 hsa-miR-1229-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 27107012, 32296183
GO:0005615 Component Extracellular space IBA 21873635
GO:0007275 Process Multicellular organism development IEA
GO:0030514 Process Negative regulation of BMP signaling pathway IBA 21873635
GO:0032281 Component AMPA glutamate receptor complex IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619794 37203 ENSG00000174453
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID B2RUY7
Protein name von Willebrand factor C domain-containing protein 2-like (VWC2-like protein) (Brorin-like)
Protein function May play a role in neurogenesis. May play a role in bone differentiation and matrix mineralization.
Family and domains
Sequence 
MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFV
YKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG
KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAG
TTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTV
Sequence length 222
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 31374203
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 29942085 ClinVar
Neuroticism Neuroticism GWAS
Insomnia Insomnia GWAS
Metabolic Syndrome Metabolic Syndrome GWAS