Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
400916
Gene name Gene Name - the full gene name approved by the HGNC.
Coiled-coil-helix-coiled-coil-helix domain containing 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CHCHD10
Synonyms (NCBI Gene) Gene synonyms aliases
C22orf16, FTDALS2, IMMD, MIX17A, N27C7-4, SMAJ
Disease Acronyms (UniProt) Disease acronyms from UniProt database
FTDALS2, IMMD, SMAJ
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a mitochondrial protein that is enriched at cristae junctions in the intermembrane space. It may play a role in cristae morphology maintenance or oxidative phosphorylation. Mutations in this gene cause frontotemporal dementia and/or amyo
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050245 hsa-miR-25-3p CLASH 23622248
MIRT048969 hsa-miR-92a-3p CLASH 23622248
MIRT043230 hsa-miR-324-5p CLASH 23622248
MIRT041543 hsa-miR-193b-3p CLASH 23622248
MIRT888576 hsa-miR-1225-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 26666268, 27499296, 30496485, 30530185
GO:0005634 Component Nucleus IBA 21873635
GO:0005739 Component Mitochondrion IBA 21873635
GO:0005739 Component Mitochondrion IDA 20888800
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615903 15559 ENSG00000250479
Protein
UniProt ID Q8WYQ3
Protein name Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial (Protein N27C7-4)
Protein function May be involved in the maintenance of mitochondrial organization and mitochondrial cristae structure.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06747 CHCH 102 134 CHCH domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Higher expression is observed in heart and liver. {ECO:0000269|PubMed:24934289}.
Sequence
MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSA
VGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLS
LCEGFSEALKQCKY
YHGLSSLP
Sequence length 142
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Amyotrophic lateral sclerosis  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Amyotrophic lateral sclerosis Amyotrophic Lateral Sclerosis, Amyotrophic lateral sclerosis rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733
View all (171 more)
25261971, 25348633, 25113787, 25113788, 25348631, 25261972, 25155093
Apraxia Apraxias rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Cerebellar ataxia Progressive cerebellar ataxia rs28936415, rs199476133, rs540331226, rs797046006, rs863224069, rs138358708, rs1057519429, rs750959420, rs1568440440, rs1597846084, rs759460806, rs761486324, rs1240335250, rs1596489887
Frontotemporal dementia Frontotemporal dementia rs63751273, rs63750376, rs63750424, rs63750972, rs1568327531, rs63750570, rs63750756, rs63751165, rs63750512, rs63751438, rs63750912, rs63750711, rs63750635, rs63750349, rs63750092
View all (31 more)
Unknown
Disease term Disease name Evidence References Source
Mental depression Depressive disorder ClinVar
Ptosis Blepharoptosis, Ptosis ClinVar
Mitochondrial Diseases mitochondrial disease GenCC
Amyotrophic Lateral Sclerosis amyotrophic lateral sclerosis GenCC
Associations from Text Mining
Disease Name Relationship Type References
Alcoholic Neuropathy Associate 32437855
Alzheimer Disease Associate 28069311
Amyotrophic Lateral Sclerosis Associate 24934289, 25726362, 28069311, 29121267, 29519717, 29789341, 30014597, 30084972, 32437855
Amyotrophic lateral sclerosis 1 Associate 33749723
Cataract Nuclear Progressive Associate 29540477
Deafness Associate 30014597
Dementia Associate 25726362
Facial Nerve Diseases Associate 30293881
Frontotemporal Dementia Associate 24934289, 25726362, 26344877, 28069311, 28749476, 29121267, 29519717, 30084972, 38320749
Hearing Loss Sensorineural Associate 25726362