Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4009
Gene name Gene Name - the full gene name approved by the HGNC.
LIM homeobox transcription factor 1 alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LMX1A
Synonyms (NCBI Gene) Gene synonyms aliases
DFNA7, LMX1, LMX1.1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a homeodomain and LIM-domain containing protein. The encoded protein is a transcription factor that acts as a positive regulator of insulin gene transcription. This gene also plays a role in the development of dopamine producing neurons
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1571177726 C>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT612813 hsa-miR-377-3p HITS-CLIP 23824327
MIRT612812 hsa-miR-342-3p HITS-CLIP 23824327
MIRT612811 hsa-miR-8485 HITS-CLIP 23824327
MIRT630429 hsa-miR-329-3p HITS-CLIP 23824327
MIRT630428 hsa-miR-362-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding ISS
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600298 6653 ENSG00000162761
Protein
UniProt ID Q8TE12
Protein name LIM homeobox transcription factor 1-alpha (LIM/homeobox protein 1.1) (LMX-1.1) (LIM/homeobox protein LMX1A)
Protein function Acts as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. Required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing ver
PDB 8IK5 , 8IKE , 8ILW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 35 90 LIM domain Domain
PF00412 LIM 94 152 LIM domain Domain
PF00046 Homeodomain 196 252 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is expressed in many tissues. Not found in heart, liver, spleen and testis. Relatively highly expressed in fetal brain. Isoform LMX1A-4AB is expressed in testis. {ECO:0000269|PubMed:12062816}.
Sequence
MLDGLKMEENFQSAIDTSASFSSLLGRAVSPKSVCEGCQRVILDRFLLRLNDSFWHEQCV
QCASCKEPLETTCFYRDKKLYCKYDYEKLF
AVKCGGCFEAIAPNEFVMRAQKSVYHLSCF
CCCVCERQLQKGDEFVLKEGQLLCKGDYEKER
ELLSLVSPAASDSGKSDDEESLCKSAHG
AGKGTAEEGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQ
VWFQNQRAKMKK
LARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTALPTPQQLL
AIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGP
LQSRVGNPIDHLYSMQNSYFTS
Sequence length 382
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Deafness Autosomal dominant nonsyndromic hearing loss 7 rs1571147567, rs1571177726 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or gastroesophageal reflux disease N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Diabetes Glycaemic response to GLP-1 agonist treatment in type 2 diabetes (HbA1c reduction) N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 24407576
Alzheimer Disease Associate 37665736
Cakut Associate 30910156
Carcinogenesis Associate 24018208
Carcinoma Non Small Cell Lung Inhibit 32751497
Carcinoma Renal Cell Associate 32207384
Carcinoma Squamous Cell Associate 24407576
Colorectal Neoplasms Associate 31547144
Deafness Associate 29754270
Diabetes Mellitus Type 2 Associate 19761607