ZNF880 (zinc finger protein 880)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
400713
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 880
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF880
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.41
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT1542440 hsa-miR-19a CLIP-seq
MIRT1542441 hsa-miR-19b CLIP-seq
MIRT1542442 hsa-miR-4708-3p CLIP-seq
MIRT1542443 hsa-miR-4761-5p CLIP-seq
MIRT1542444 hsa-miR-581 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0005634 Component Nucleus IBA 21873635
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA 21873635
GO:0046872 Function Metal ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q6PDB4
Protein name Zinc finger protein 880
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 6 → 47 KRAB box Family
PF00096 zf-C2H2 212 → 234 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 240 → 262 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 268 → 290 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 296 → 318 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 324 → 346 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 352 → 374 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 380 → 402 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 408 → 430 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 464 → 486 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 492 → 514 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 520 → 542 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 548 → 570 Zinc finger, C2H2 type Domain
Sequence 
MLRRGHLAFRDVAIEFPQEEWKCLDPAQRTLYREVMVENYRNLVFLGICLPDLSVISMLE
QRRDPRNLQSEVKIANNPGGRECIKGVNAESSSKLGSNAGNKSLKNQLGLTFQLHLSELQ
LFQAERNISGCKHVEKPINNSLVSPLQKIYSSVKSHILNKYRNDFDDSPFLPQEQKAQIR
EKPCECNEHGKAFRVSSRLANNQVIHTADNPYKCNECDKVFSNSSNLVQHQRIHTGEKPY
KCHECGKLFNRISLLARHQRIHTGEKPYKCHECGKVFTQNSHLANHHRIHTGEKPYKCNE
CGKVFNRNAHLARHQKIHSGEKPYKCKECGKAFSGGSGLTAHLVIHTGEKLYKCNKCGKV
FNRNAHLTRHQRIHTGEKPYECKECGKVFRHKFCLTNHHRMHTGEQPYKCNECGKAFRDC
SGLTAHLLIHTGEKPYKCKECAKVFRHRLSLSNHQRFHTGEKPYRCDECGKDFTRNSNLA
NHHRIHTGEKPYKCSECHKVFSHNSHLARHRQIHTGEKSYKCNECGKVFSHKLYLKKHER
IHTGEKPYRCHECGKDFTRNSNLANHHRIHTGEKPYR
Sequence length 577
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Alzheimer disease Alzheimer disease GWAS
Show/Hide Text Mining Associations (5)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 33371069
Colonic Neoplasms Associate 37370088
Colorectal Neoplasms Inhibit 37370088
Osteoarthritis Associate 33691763
Rectal Neoplasms Associate 37370088