LMO2 (LIM domain only 2)

Gene

• Entrez ID: 4005
• Gene name: LIM domain only 2
• Gene symbol: LMO2
• Synonyms (NCBI Gene): LMO-2, RBTN2, RBTNL1, RHOM2, TTG2
• Chromosome: 11
• Chromosome location: 11p13
• Summary: LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approxima

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000130	hsa-miR-223-3p	Review	20029422
MIRT000130	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	19278969
MIRT000130	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	19278969
MIRT000130	hsa-miR-223-3p	Reporter assay	19017354
MIRT000130	hsa-miR-223-3p	Luciferase reporter assay, Next Generation Sequencing (NGS), qRT-PCR, RNA-binding protein immunoprecipitation, Western blot	28303002
MIRT000130	hsa-miR-223-3p	Luciferase reporter assay, Next Generation Sequencing (NGS), qRT-PCR, RNA-binding protein immunoprecipitation, Western blot	28303002
MIRT1111875	hsa-miR-136	CLIP-seq
MIRT1111876	hsa-miR-3189-3p	CLIP-seq
MIRT1111877	hsa-miR-4328	CLIP-seq
MIRT1111878	hsa-miR-502-5p	CLIP-seq
MIRT2262023	hsa-miR-4477a	CLIP-seq
MIRT2262024	hsa-miR-616	CLIP-seq
MIRT2262025	hsa-miR-622	CLIP-seq
MIRT2453075	hsa-miR-1245b-5p	CLIP-seq
MIRT2453076	hsa-miR-3142	CLIP-seq
MIRT1111876	hsa-miR-3189-3p	CLIP-seq
MIRT2453077	hsa-miR-4720-3p	CLIP-seq
MIRT2453078	hsa-miR-4753-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MYB	Activation	20686118
PRDM1	Repression	21722313

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001221	Function	Transcription coregulator binding	IPI	16314316
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	16314316
GO:0005515	Function	Protein binding	IPI	16189514, 16314316, 21516116, 21988832, 25416956, 28514442, 29892012, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	16314316
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043425	Function	BHLH transcription factor binding	IPI	16314316
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16314316
GO:0046872	Function	Metal ion binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	16314316
GO:0140297	Function	DNA-binding transcription factor binding	IBA

Other IDs

• MIM: 180385
• HGNC: 6642
• e!Ensembl: ENSG00000135363

Protein

• UniProt ID: P25791
• Protein name: Rhombotin-2 (Cysteine-rich protein TTG-2) (LIM domain only protein 2) (LMO-2) (T-cell translocation protein 2)
• Protein function: Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.
• PDB: 2XJY, 2XJZ, 2YPA, 4KFZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	30 → 88	LIM domain	Domain
  PF00412	LIM	94 → 152	LIM domain	Domain

• Sequence:

  MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC
  GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF
  KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI

• Sequence length: 158

Pathways

KEGG:

Transcriptional misregulation in cancer

Reactome:

RUNX1 regulates transcription of genes involved in differentiation of HSCs

<