LMO1 (LIM domain only 1)

Gene

• Entrez ID: 4004
• Gene name: LIM domain only 1
• Gene symbol: LMO1
• Synonyms (NCBI Gene): RBTN1, RHOM1, TTG1
• Chromosome: 11
• Chromosome location: 11p15.4
• Summary: This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1111866	hsa-miR-181a	CLIP-seq
MIRT1111867	hsa-miR-181b	CLIP-seq
MIRT1111868	hsa-miR-181c	CLIP-seq
MIRT1111869	hsa-miR-181d	CLIP-seq
MIRT1111870	hsa-miR-3163	CLIP-seq
MIRT1111871	hsa-miR-4261	CLIP-seq
MIRT1111872	hsa-miR-4262	CLIP-seq
MIRT1111873	hsa-miR-494	CLIP-seq
MIRT1111874	hsa-miR-543	CLIP-seq
MIRT2262020	hsa-miR-4438	CLIP-seq
MIRT2262021	hsa-miR-4494	CLIP-seq
MIRT2262022	hsa-miR-5095	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARX	Unknown	23771350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 27107012, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20855495
GO:0046013	Process	Regulation of T cell homeostatic proliferation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IBA

Other IDs

• MIM: 186921
• HGNC: 6641
• e!Ensembl: ENSG00000166407

Protein

• UniProt ID: P25800
• Protein name: Rhombotin-1 (Cysteine-rich protein TTG-1) (LIM domain only protein 1) (LMO-1) (T-cell translocation protein 1)
• Protein function: May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	24 → 82	LIM domain	Domain
  PF00412	LIM	88 → 146	LIM domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed mainly in the central nervous. Low level of expression in other tissues including thymus. {ECO:0000269|PubMed:2052354}.
• Sequence:

  MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGE
  VGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCN
  QRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ

• Sequence length: 156

Pathways

Reactome:

RUNX1 regulates transcription of genes involved in differentiation of HSCs

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Neuroblastoma	Neuroblastoma	N/A	N/A	GWAS
Restless Legs Syndrome	Restless legs syndrome	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Adrenal Gland Neoplasms	Associate	27009839
Ataxia Telangiectasia	Associate	12086890
Breast Neoplasms	Associate	40076569
Carcinogenesis	Associate	21124317, 33870932
Colorectal Neoplasms	Associate	24845030
Leukemia	Associate	7957052
Lung Neoplasms	Stimulate	33870932
Neoplasms	Stimulate	24845030
Neoplasms	Associate	28260788, 29695398, 30194082, 33870932
Neuroblastoma	Associate	21124317, 21436895, 23222812, 25312269, 26030754, 27009839, 29695398, 30194082, 31819055, 33870932
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	2501659
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	14604958, 15054041, 22058201, 24367274, 28260788, 28854983, 8078932, 9020185
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	33870932
Prostatic Neoplasms	Associate	33870932
Stomach Neoplasms	Stimulate	33870932