COLCA1 (colorectal cancer associated 1)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 399948
Gene name Colorectal cancer associated 1
Gene symbol COLCA1
Synonyms (NCBI Gene)
C11orf92CASC12LOH11CR1F
Chromosome 11
Chromosome location 11q23.1
Summary This gene encodes a transmembrane protein that localizes to granular structures, including crystalloid eosinophilic granules and other granular organelles. This gene, along with an overlapping opposite strand gene, has been implicated as a susceptibility
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Gene Gene ontology Other IDs Protein
Show/Hide all (2)
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IDA 24154973
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
615693 33789 ENSG00000196167
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZS62
Protein name Colorectal cancer-associated protein 1
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in gastrointestinal and immune tissue, as well as prostate, testis and ovary. Expressed in lamina propria and eosinophils but not in epithelial cells. Expression is greater in benign adjacent tissues than in colon tumors. {EC
Sequence 
MESCSVAQAGVLTSPFMWRWTGMAGALSALDNTIEDDADDQLPCGEGRPGWVRGELLGSQ
GVCKDSKDLFVPTSSSLYGCFCVGLVSGMAISVLLLASDFRKLDFSRPEPCFEKEASLWF
VAQH
Sequence length 124
Interactions View interactions