FOXI2 (forkhead box I2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
399823
Gene name Gene Name - the full gene name approved by the HGNC.
Forkhead box I2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOXI2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q26.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(633)
miRTarBase ID miRNA Experiments Reference
MIRT610145 hsa-miR-8485 HITS-CLIP 19536157
MIRT610144 hsa-miR-329-3p HITS-CLIP 19536157
MIRT610143 hsa-miR-362-3p HITS-CLIP 19536157
MIRT610141 hsa-miR-1228-3p HITS-CLIP 19536157
MIRT610140 hsa-miR-4639-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617202 32448 ENSG00000186766
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q6ZQN5
Protein name Forkhead box protein I2
Protein function Possible transcriptional activator.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 101 → 187 Forkhead domain Domain
Sequence 
MATYCDDLGPSSAPPGQAQATAHPPGYEPGDLGAVGGGPLLWVNAPALSPKSYASGPGPA
PPYAAPSYGAPGPLLGAPGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPL
RKLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDP
NCEKMFDNGNFRRKRKRRAEASAAVRSGARSVGGAEAPALEPPSAACLDLQASPSPSAPE
AATCFSGFASAMSALAGGLGTFPGGLAGDFSFGRRPPTVATHAPQTLNPSPGFAPGHQTA
AAGFRLSHLLYSREGTEV
Sequence length 318
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dental caries Dental caries N/A N/A GWAS
Insomnia SSRI response to insomnia syndromal factor measured by HAM-D-21 in major depressive disorder N/A N/A GWAS
Show/Hide Text Mining Associations (6)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 34222478
Carcinoma Renal Cell Associate 32633782, 33510822
Colorectal Neoplasms Associate 24485021
Mouth Neoplasms Associate 26342026
Squamous Cell Carcinoma of Head and Neck Associate 26342026
Vesico Ureteral Reflux Associate 29097723