EEF1AKMT2 (EEF1A lysine methyltransferase 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 399818
Gene name EEF1A lysine methyltransferase 2
Gene symbol EEF1AKMT2
Synonyms (NCBI Gene)
C10orf138Efm4METTL10
Chromosome 10
Chromosome location 10q26.13
miRNA miRNA information provided by mirtarbase database.
9
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (9)
miRTarBase ID miRNA Experiments Reference
MIRT663091 hsa-miR-6782-3p HITS-CLIP 23824327
MIRT663090 hsa-miR-3121-5p HITS-CLIP 23824327
MIRT663089 hsa-miR-412-3p HITS-CLIP 23824327
MIRT663088 hsa-miR-6754-3p HITS-CLIP 23824327
MIRT663087 hsa-miR-548aw HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IDA 25144183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 25144183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
617794 33787 ENSG00000203791
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5JPI9
Protein name EEF1A lysine methyltransferase 2 (EC 2.1.1.-) (Methyltransferase-like protein 10) (Protein-lysine N-methyltransferase METTL10)
Protein function [Isoform 2]: Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-318'.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13847 Methyltransf_31 79 → 245 Methyltransferase domain Domain
Sequence 
MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWF
GEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGS
IIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRV
LKVKGFFLITSCNWTKEELLNEFSEGWSTVAGFWLTAALTSWAQAIFSTSASRVGGTTGT
HHHAWIIFVFLAETRFCHVVQAGLELLGSSDSPTWPPKVLGLYHARPSLAF
Sequence length 291
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    Protein methylation