CTXN2 (cortexin 2)

Gene

• Entrez ID: 399697
• Gene name: Cortexin 2
• Gene symbol: CTXN2
• Synonyms (NCBI Gene): -
• Chromosome: 15
• Chromosome location: 15q21.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT916318	hsa-miR-2052	CLIP-seq
MIRT916319	hsa-miR-2278	CLIP-seq
MIRT916320	hsa-miR-2682	CLIP-seq
MIRT916321	hsa-miR-30a	CLIP-seq
MIRT916322	hsa-miR-30b	CLIP-seq
MIRT916323	hsa-miR-30c	CLIP-seq
MIRT916324	hsa-miR-30d	CLIP-seq
MIRT916325	hsa-miR-30e	CLIP-seq
MIRT916326	hsa-miR-3189-3p	CLIP-seq
MIRT916327	hsa-miR-3714	CLIP-seq
MIRT916328	hsa-miR-3922-5p	CLIP-seq
MIRT916329	hsa-miR-4277	CLIP-seq
MIRT916330	hsa-miR-4307	CLIP-seq
MIRT916331	hsa-miR-4426	CLIP-seq
MIRT916332	hsa-miR-449c	CLIP-seq
MIRT916333	hsa-miR-450b-5p	CLIP-seq
MIRT916334	hsa-miR-4647	CLIP-seq
MIRT916335	hsa-miR-4662b	CLIP-seq
MIRT916336	hsa-miR-4747-5p	CLIP-seq
MIRT916337	hsa-miR-4768-5p	CLIP-seq
MIRT916338	hsa-miR-4775	CLIP-seq
MIRT916339	hsa-miR-507	CLIP-seq
MIRT916340	hsa-miR-557	CLIP-seq
MIRT916341	hsa-miR-567	CLIP-seq
MIRT916342	hsa-miR-660	CLIP-seq
MIRT1971751	hsa-miR-3136-3p	CLIP-seq
MIRT1971752	hsa-miR-328	CLIP-seq
MIRT1971753	hsa-miR-3545-3p	CLIP-seq
MIRT1971754	hsa-miR-3677-5p	CLIP-seq
MIRT1971755	hsa-miR-376a	CLIP-seq
MIRT1971756	hsa-miR-376b	CLIP-seq
MIRT916341	hsa-miR-567	CLIP-seq
MIRT916320	hsa-miR-2682	CLIP-seq
MIRT916327	hsa-miR-3714	CLIP-seq
MIRT916328	hsa-miR-3922-5p	CLIP-seq
MIRT916332	hsa-miR-449c	CLIP-seq
MIRT2510698	hsa-miR-150	CLIP-seq
MIRT2510699	hsa-miR-188-3p	CLIP-seq
MIRT2510700	hsa-miR-3183	CLIP-seq
MIRT2510701	hsa-miR-4713-5p	CLIP-seq
MIRT2510702	hsa-miR-4723-3p	CLIP-seq
MIRT2510703	hsa-miR-532-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: P0C2S0
• Protein name: Cortexin-2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11057	Cortexin	6 → 81	Cortexin of kidney	Family

• Sequence:

  MSSTYCGNSSAKMSVNEVSAFSLTLEQKTGFAFVGILCIFLGLLIIRCFKILLDPYSSMP
  SSTWEDEVEEFDKGTFEYALA

• Sequence length: 81

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BENIGN NEOPLASM OF EYE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Sleep Initiation and Maintenance Disorders	Inhibit	33530007	★☆☆☆☆ Found in Text Mining only