SLC25A35 (solute carrier family 25 member 35)

Gene

• Entrez ID: 399512
• Gene name: Solute carrier family 25 member 35
• Gene symbol: SLC25A35
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1356446	hsa-miR-1280	CLIP-seq
MIRT1356447	hsa-miR-1915	CLIP-seq
MIRT1356448	hsa-miR-4258	CLIP-seq
MIRT1356449	hsa-miR-4270	CLIP-seq
MIRT1356450	hsa-miR-4441	CLIP-seq
MIRT1356451	hsa-miR-4479	CLIP-seq
MIRT1356452	hsa-miR-4537	CLIP-seq
MIRT1356453	hsa-miR-4755-3p	CLIP-seq
MIRT1356454	hsa-miR-483-3p	CLIP-seq
MIRT2105597	hsa-miR-1283	CLIP-seq
MIRT2105598	hsa-miR-3189-5p	CLIP-seq
MIRT2105599	hsa-miR-335	CLIP-seq
MIRT2105600	hsa-miR-3929	CLIP-seq
MIRT2105601	hsa-miR-4282	CLIP-seq
MIRT2105602	hsa-miR-4419b	CLIP-seq
MIRT2105603	hsa-miR-4478	CLIP-seq
MIRT2105604	hsa-miR-4722-5p	CLIP-seq
MIRT2105605	hsa-miR-485-5p	CLIP-seq
MIRT2105606	hsa-miR-548c-3p	CLIP-seq
MIRT2330065	hsa-miR-1273	CLIP-seq
MIRT2330066	hsa-miR-1827	CLIP-seq
MIRT2105599	hsa-miR-335	CLIP-seq
MIRT2330067	hsa-miR-34c-3p	CLIP-seq
MIRT2330068	hsa-miR-3614-5p	CLIP-seq
MIRT2330069	hsa-miR-3683	CLIP-seq
MIRT2330070	hsa-miR-376c	CLIP-seq
MIRT2105600	hsa-miR-3929	CLIP-seq
MIRT2105602	hsa-miR-4419b	CLIP-seq
MIRT2330071	hsa-miR-4433	CLIP-seq
MIRT2105603	hsa-miR-4478	CLIP-seq
MIRT2330072	hsa-miR-4649-3p	CLIP-seq
MIRT2105604	hsa-miR-4722-5p	CLIP-seq
MIRT2105605	hsa-miR-485-5p	CLIP-seq
MIRT2330073	hsa-miR-940	CLIP-seq
MIRT2394667	hsa-miR-3689d	CLIP-seq
MIRT2394668	hsa-miR-3690	CLIP-seq
MIRT2394669	hsa-miR-4254	CLIP-seq
MIRT2394670	hsa-miR-4418	CLIP-seq
MIRT2394671	hsa-miR-509-3-5p	CLIP-seq
MIRT2394672	hsa-miR-509-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 610818
• HGNC: 31921
• e!Ensembl: ENSG00000125434

Protein

• UniProt ID: Q3KQZ1
• Protein name: Solute carrier family 25 member 35
• Protein function: Putative antiporter that exchanges dicarboxylates and sulfur oxoanions across the inner membrane of mitochondria.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00153	Mito_carr	1 → 90	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	98 → 197	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	202 → 299	Mitochondrial carrier protein	Family

• Sequence:

  MDFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGLA
  ALQKGLAPALLYQFLMNGIRLGTYGLAEAGGYLHTAEGTHSPARSAAAGAMAGVMGAYLG
  SPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGS
  STQLCTFSSTKDLLSQWEIFPPQSWKLALVAAMMSGIAVVLAMAPFDVACTRLYNQPTDA
  QGKGLMYRGILDALLQTARTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSLYYTDTK
  

• Sequence length: 300

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIAC ARRHYTHMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations