Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	399
Gene name	Ras homolog family member H
Gene symbol	RHOH
Synonyms (NCBI Gene)	ARHHIMD129TTF
Chromosome	4
Chromosome location	4p14
Summary	The protein encoded by this gene is a member of the Ras superfamily of guanosine triphosphate (GTP)-metabolizing enzymes. The encoded protein is expressed in hematopoietic cells, where it functions as a negative regulator of cell growth and survival. This

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs773779601	C>G,T	Risk-factor	Coding sequence variant, synonymous variant, stop gained

Show/Hide all (88)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053367	hsa-miR-9-5p	MicroarrayqRT-PCR	23798388
MIRT721874	hsa-miR-3065-5p	HITS-CLIP	19536157
MIRT721873	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT721872	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT721871	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT721870	hsa-miR-676-5p	HITS-CLIP	19536157
MIRT721869	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT721868	hsa-miR-505-3p	HITS-CLIP	19536157
MIRT721867	hsa-miR-421	HITS-CLIP	19536157
MIRT721866	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT709509	hsa-miR-3609	HITS-CLIP	19536157
MIRT709508	hsa-miR-548ah-5p	HITS-CLIP	19536157
MIRT709507	hsa-miR-520g-3p	HITS-CLIP	19536157
MIRT709506	hsa-miR-520h	HITS-CLIP	19536157
MIRT709505	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT709504	hsa-miR-340-3p	HITS-CLIP	19536157
MIRT709503	hsa-miR-6827-3p	HITS-CLIP	19536157
MIRT709502	hsa-miR-6787-3p	HITS-CLIP	19536157
MIRT709501	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT709500	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT709499	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT691959	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT691958	hsa-miR-455-5p	HITS-CLIP	23313552
MIRT691957	hsa-miR-500b-3p	HITS-CLIP	23313552
MIRT691956	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT691955	hsa-miR-1227-3p	HITS-CLIP	23313552
MIRT691954	hsa-miR-4775	HITS-CLIP	23313552
MIRT691953	hsa-miR-4715-3p	HITS-CLIP	23313552
MIRT691952	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT731229	hsa-miR-365a-3p	qRT-PCR	26337230
MIRT731229	hsa-miR-365a-3p	qRT-PCR	26337230
MIRT721874	hsa-miR-3065-5p	HITS-CLIP	19536157
MIRT721873	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT721872	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT721871	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT721870	hsa-miR-676-5p	HITS-CLIP	19536157
MIRT721869	hsa-miR-7159-5p	HITS-CLIP	19536157
MIRT721868	hsa-miR-505-3p	HITS-CLIP	19536157
MIRT721867	hsa-miR-421	HITS-CLIP	19536157
MIRT721866	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT709509	hsa-miR-3609	HITS-CLIP	19536157
MIRT709508	hsa-miR-548ah-5p	HITS-CLIP	19536157
MIRT709507	hsa-miR-520g-3p	HITS-CLIP	19536157
MIRT709506	hsa-miR-520h	HITS-CLIP	19536157
MIRT709505	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT709504	hsa-miR-340-3p	HITS-CLIP	19536157
MIRT709503	hsa-miR-6827-3p	HITS-CLIP	19536157
MIRT709502	hsa-miR-6787-3p	HITS-CLIP	19536157
MIRT709501	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT709500	hsa-miR-6778-3p	HITS-CLIP	19536157
MIRT709499	hsa-miR-6807-5p	HITS-CLIP	19536157
MIRT691959	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT691958	hsa-miR-455-5p	HITS-CLIP	23313552
MIRT691957	hsa-miR-500b-3p	HITS-CLIP	23313552
MIRT691956	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT691955	hsa-miR-1227-3p	HITS-CLIP	23313552
MIRT691954	hsa-miR-4775	HITS-CLIP	23313552
MIRT691953	hsa-miR-4715-3p	HITS-CLIP	23313552
MIRT691952	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT1305980	hsa-miR-513a-3p	CLIP-seq
MIRT1305981	hsa-miR-660	CLIP-seq
MIRT2090632	hsa-miR-1305	CLIP-seq
MIRT2090633	hsa-miR-140-5p	CLIP-seq
MIRT2090634	hsa-miR-4480	CLIP-seq
MIRT2090635	hsa-miR-4709-5p	CLIP-seq
MIRT2315303	hsa-miR-1825	CLIP-seq
MIRT2315304	hsa-miR-199a-5p	CLIP-seq
MIRT2315305	hsa-miR-199b-5p	CLIP-seq
MIRT2315306	hsa-miR-3606	CLIP-seq
MIRT2315307	hsa-miR-3677-5p	CLIP-seq
MIRT2315308	hsa-miR-3926	CLIP-seq
MIRT2315309	hsa-miR-4280	CLIP-seq
MIRT2315310	hsa-miR-4307	CLIP-seq
MIRT2315311	hsa-miR-4703-3p	CLIP-seq
MIRT2315312	hsa-miR-548s	CLIP-seq
MIRT2315313	hsa-miR-570	CLIP-seq
MIRT2315314	hsa-miR-921	CLIP-seq
MIRT2393716	hsa-miR-1290	CLIP-seq
MIRT2393717	hsa-miR-193a-3p	CLIP-seq
MIRT2393718	hsa-miR-193b	CLIP-seq
MIRT2393719	hsa-miR-4263	CLIP-seq
MIRT2393720	hsa-miR-576-5p	CLIP-seq
MIRT2393721	hsa-miR-582-3p	CLIP-seq
MIRT2689755	hsa-miR-1343	CLIP-seq
MIRT2689756	hsa-miR-3074-5p	CLIP-seq
MIRT2689757	hsa-miR-3124-3p	CLIP-seq
MIRT2689758	hsa-miR-3591-3p	CLIP-seq
MIRT2315313	hsa-miR-570	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001772	Component	Immunological synapse	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005095	Function	GTPase inhibitor activity	NAS	11809807
GO:0005515	Function	Protein binding	IPI	11809807, 32296183
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	11809807
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	11809807
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	11809807
GO:0007015	Process	Actin filament organization	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0019210	Function	Kinase inhibitor activity	IDA	11809807
GO:0019901	Function	Protein kinase binding	IBA
GO:0030217	Process	T cell differentiation	IEA
GO:0030217	Process	T cell differentiation	NAS	11809807
GO:0031267	Function	Small GTPase binding	NAS	11809807
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	11809807
GO:0045576	Process	Mast cell activation	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IMP	22850876

MIM	HGNC	e!Ensembl
602037	686	ENSG00000168421

Q15669

Protein name

Rho-related GTP-binding protein RhoH (GTP-binding protein TTF) (Translocation three four protein)

Protein function

Negative regulator of hematopoietic progenitor cell proliferation, survival and migration. Critical regulator of thymocyte development and T-cell antigen receptor (TCR) signaling by mediating recruitment and activation of ZAP70. Required for pho

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	6 → 172	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed only in hematopoietic cells. Present at very high levels in the thymus, less abundant in the spleen, and least abundant in the bone marrow. Expressed at a higher level in the TH1 subtype of T-helper cells than in the TH2 subp

Sequence

MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTA
GNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQ
REMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRR
RLFSINECKIF

Sequence length

191

Interactions

View interactions

	KEGG		Reactome
	Leukocyte transendothelial migration Salmonella infection		Rho GTPase cycle

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Epidermodysplasia verruciformis, susceptibility to, 4	Likely benign; no classifications from unflagged records	rs76788449, rs773779601	RCV002497200 RCV000754772
RHOH-related disorder	Likely benign; Benign	rs146170789, rs114176176, rs61731758	RCV003977074 RCV003925736 RCV003928146
T-cell immunodeficiency with epidermodysplasia verruciformis	Uncertain significance; Likely benign; Benign	rs200579964, rs750167394, rs1244021714, rs758225526, rs773671410, rs1391559187, rs368977127, rs371722683, rs2109593740, rs1346989432, rs768275793, rs145528494, rs767409335, rs777698365, rs115314968 View all (49 more)	RCV001314814 RCV001325142 RCV001365705 RCV001404837 RCV001429715 RCV001445525 RCV001461825 RCV001454653 RCV001453614 RCV001500843 RCV001481861 RCV001485678 RCV001989660 RCV001911673 RCV001958395 RCV001911921 RCV001915876 RCV002025173 RCV001880407 RCV001886497 RCV001983924 RCV001955500 RCV002041078 RCV002132604 RCV002079064 RCV002090501 RCV002115128 RCV002081739 RCV002120906 RCV002301908 RCV003074516 RCV002632877 RCV003116947 RCV002612782 RCV002614543 RCV002720534 RCV002701432 RCV002726782 RCV002820008 RCV002806566 RCV002876545 RCV002890403 RCV002994024 RCV003030775 RCV003038009 RCV003047941 RCV003595498 RCV003760657 RCV003760905 RCV003758347 RCV003759440 RCV003833451 RCV003845744 RCV000556395 RCV000549472 RCV000537125 RCV000655221 RCV000655222 RCV000700288 RCV000792176 RCV000882353 RCV000902919 RCV001406537 RCV001402013 RCV001044000 RCV001215517 RCV001212989

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	36710485
Carcinoma Renal Cell	Associate	31672930
Lymphoma	Associate	14592832, 15914563, 16156859
Lymphoma Non Hodgkin	Associate	12714522
Metabolic Syndrome	Associate	26004609
Neoplasms	Associate	30199148, 31881847

RHOH (ras homolog family member H)