Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3980
Gene name Gene Name - the full gene name approved by the HGNC.	DNA ligase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LIG3
Synonyms (NCBI Gene) Gene synonyms aliases	LIG2, LIG3alpha, MTDPS20
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MTDPS20
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the DNA ligase family. Each member of this family encodes a protein that catalyzes the joining of DNA ends but they each have a distinct role in DNA metabolism. The protein encoded by this gene is involved in excision repair and i

Show/Hide all(68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028636	hsa-miR-30a-5p	Proteomics	18668040
MIRT045688	hsa-miR-149-5p	CLASH	23622248
MIRT1109235	hsa-miR-199a-3p	CLIP-seq
MIRT1109236	hsa-miR-199b-3p	CLIP-seq
MIRT1109237	hsa-miR-3129-5p	CLIP-seq
MIRT1109238	hsa-miR-4293	CLIP-seq
MIRT1109239	hsa-miR-455-3p	CLIP-seq
MIRT1109240	hsa-miR-4712-5p	CLIP-seq
MIRT1109241	hsa-miR-770-5p	CLIP-seq
MIRT2030326	hsa-miR-1343	CLIP-seq
MIRT2030327	hsa-miR-198	CLIP-seq
MIRT2030328	hsa-miR-23a	CLIP-seq
MIRT2030329	hsa-miR-23b	CLIP-seq
MIRT2030330	hsa-miR-23c	CLIP-seq
MIRT2030331	hsa-miR-3128	CLIP-seq
MIRT2030332	hsa-miR-3155	CLIP-seq
MIRT2030333	hsa-miR-3155b	CLIP-seq
MIRT2030334	hsa-miR-3662	CLIP-seq
MIRT2030335	hsa-miR-375	CLIP-seq
MIRT2030336	hsa-miR-4326	CLIP-seq
MIRT2030337	hsa-miR-4434	CLIP-seq
MIRT2030338	hsa-miR-4464	CLIP-seq
MIRT2030339	hsa-miR-4470	CLIP-seq
MIRT2030340	hsa-miR-4516	CLIP-seq
MIRT2030341	hsa-miR-4531	CLIP-seq
MIRT2030342	hsa-miR-4696	CLIP-seq
MIRT2030343	hsa-miR-4717-3p	CLIP-seq
MIRT2030344	hsa-miR-4748	CLIP-seq
MIRT2030345	hsa-miR-484	CLIP-seq
MIRT2261056	hsa-miR-1207-3p	CLIP-seq
MIRT2030326	hsa-miR-1343	CLIP-seq
MIRT2261057	hsa-miR-1910	CLIP-seq
MIRT2261058	hsa-miR-2392	CLIP-seq
MIRT2030328	hsa-miR-23a	CLIP-seq
MIRT2030329	hsa-miR-23b	CLIP-seq
MIRT2030330	hsa-miR-23c	CLIP-seq
MIRT2261059	hsa-miR-300	CLIP-seq
MIRT2030331	hsa-miR-3128	CLIP-seq
MIRT2030332	hsa-miR-3155	CLIP-seq
MIRT2030333	hsa-miR-3155b	CLIP-seq
MIRT2261060	hsa-miR-3156-5p	CLIP-seq
MIRT2261061	hsa-miR-3616-3p	CLIP-seq
MIRT2261062	hsa-miR-3688-5p	CLIP-seq
MIRT2030335	hsa-miR-375	CLIP-seq
MIRT2261063	hsa-miR-381	CLIP-seq
MIRT2261064	hsa-miR-3929	CLIP-seq
MIRT2030336	hsa-miR-4326	CLIP-seq
MIRT2261065	hsa-miR-4419b	CLIP-seq
MIRT2261066	hsa-miR-4427	CLIP-seq
MIRT2261067	hsa-miR-4436b-3p	CLIP-seq
MIRT2030338	hsa-miR-4464	CLIP-seq
MIRT2030339	hsa-miR-4470	CLIP-seq
MIRT2261068	hsa-miR-4478	CLIP-seq
MIRT2261069	hsa-miR-451b	CLIP-seq
MIRT2030342	hsa-miR-4696	CLIP-seq
MIRT2030343	hsa-miR-4717-3p	CLIP-seq
MIRT2030344	hsa-miR-4748	CLIP-seq
MIRT2030345	hsa-miR-484	CLIP-seq
MIRT2261070	hsa-miR-572	CLIP-seq
MIRT2261071	hsa-miR-617	CLIP-seq
MIRT2261072	hsa-miR-634	CLIP-seq
MIRT1109235	hsa-miR-199a-3p	CLIP-seq
MIRT1109236	hsa-miR-199b-3p	CLIP-seq
MIRT1109237	hsa-miR-3129-5p	CLIP-seq
MIRT1109238	hsa-miR-4293	CLIP-seq
MIRT1109239	hsa-miR-455-3p	CLIP-seq
MIRT1109240	hsa-miR-4712-5p	CLIP-seq
MIRT1109241	hsa-miR-770-5p	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	TAS
GO:0003677	Function	DNA binding	IEA
GO:0003909	Function	DNA ligase activity	IDA	9809069
GO:0003909	Function	DNA ligase activity	TAS
GO:0003910	Function	DNA ligase (ATP) activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	15744309, 24407287, 25609649
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005739	Component	Mitochondrion	IEA
GO:0006266	Process	DNA ligation	IBA	21873635
GO:0006273	Process	Lagging strand elongation	IBA	21873635
GO:0006283	Process	Transcription-coupled nucleotide-excision repair	TAS
GO:0006288	Process	Base-excision repair, DNA ligation	IBA	21873635
GO:0006288	Process	Base-excision repair, DNA ligation	IDA	19589734
GO:0006288	Process	Base-excision repair, DNA ligation	TAS
GO:0006297	Process	Nucleotide-excision repair, DNA gap filling	TAS
GO:0006302	Process	Double-strand break repair	IDA	19589734
GO:0007049	Process	Cell cycle	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0033151	Process	V(D)J recombination	IDA	9809069
GO:0043504	Process	Mitochondrial DNA repair	IBA	21873635
GO:0051301	Process	Cell division	IEA
GO:0070421	Component	DNA ligase III-XRCC1 complex	IBA	21873635
GO:0071897	Process	DNA biosynthetic process	IEA
GO:0090298	Process	Negative regulation of mitochondrial DNA replication	IMP	21878356
GO:0097681	Process	Double-strand break repair via alternative nonhomologous end joining	IBA	21873635

MIM	HGNC	e!Ensembl
600940	6600	ENSG00000005156

Protein

UniProt ID

P49916

Protein name

DNA ligase 3 (EC 6.5.1.1) (DNA ligase III) (Polydeoxyribonucleotide synthase [ATP] 3)

Protein function

Isoform 3 functions as a heterodimer with DNA-repair protein XRCC1 in the nucleus and can correct defective DNA strand-break repair and sister chromatid exchange following treatment with ionizing radiation and alkylating agents. Isoform 1 is tar

PDB

1IMO , 1IN1 , 1UW0 , 3L2P , 3PC7 , 3PC8 , 3QVG , 6WH1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00645	zf-PARP	96 → 181	Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region	Domain
PF04675	DNA_ligase_A_N	263 → 434	DNA ligase N terminus	Family
PF01068	DNA_ligase_A_M	483 → 677	ATP dependent DNA ligase domain	Domain
PF04679	DNA_ligase_A_C	704 → 814		Family
PF16759	LIG3_BRCT	933 → 1005	DNA ligase 3 BRCT domain	Family

Tissue specificity

TISSUE SPECIFICITY: Testis, thymus, prostate and heart.

Sequence

MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQ
GSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSAKPNNSGEAP
SSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTP
VQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQEGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPS
AMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFV
AFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC

Sequence length

1009

Interactions

View interactions

	KEGG		Reactome
	Base excision repair		Resolution of AP sites via the single-nucleotide replacement pathway APEX1-Independent Resolution of AP Sites via the Single Nucleotide Replacement Pathway HDR through MMEJ (alt-NHEJ) Gap-filling DNA repair synthesis and ligation in GG-NER Gap-filling DNA repair synthesis and ligation in TC-NER

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Mitochondrial DNA Deletion Syndrome	mitochondrial DNA depletion syndrome 20 (mngie type)	GenCC
Restless Legs Syndrome	Restless Legs Syndrome	GWAS

Show/Hide Text Mining Associations (35)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Associate	23951112
Alzheimer Disease	Associate	29474873
Anencephaly	Associate	30022792
Bloom Syndrome	Associate	8265359
Breast Neoplasms	Associate	40493574
Carcinoma Hepatocellular	Associate	30310528
Carcinoma Squamous Cell	Associate	28334093
Colorectal Neoplasms	Associate	26649135, 32312920
Diabetes Mellitus	Associate	19147782
Drug Related Side Effects and Adverse Reactions	Associate	36988399
Fatty Liver	Associate	37511066
Fibrosarcoma	Associate	11994275
Fuchs' Endothelial Dystrophy	Associate	30022792
Insulin Resistance	Associate	37511066
Intestinal Pseudo Obstruction	Associate	39173721
Keratoconus	Associate	30022792
Leukemia Myeloid Acute	Associate	40493574
Leukoencephalopathies	Associate	39173721
Lung Neoplasms	Associate	30022792
Mesothelioma	Associate	22905093
Multiple Myeloma	Associate	30120376, 32079692
Myotonic Dystrophy	Associate	40493574
Neoplasms	Associate	19913990, 30120376, 31093909, 40493574
Nervous System Diseases	Associate	36988399
Neural Tube Defects	Associate	30022792
Neuroblastoma	Associate	25563294
Non alcoholic Fatty Liver Disease	Associate	37511066
Osteolysis syndrome recessive	Associate	39173721
Ovarian Neoplasms	Associate	36988399
Pain	Associate	31196165
Pancreatic Neoplasms	Associate	19147782
Signs and Symptoms Digestive	Associate	39173721
Urinary Bladder Neoplasms	Associate	19913990
Urinary Bladder Neurogenic	Associate	39173721
Visceral myopathy familial external ophthalmoplegia	Associate	30310528

LIG3 (DNA ligase 3)