Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3976
Gene name Gene Name - the full gene name approved by the HGNC.	LIF interleukin 6 family cytokine
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LIF
Synonyms (NCBI Gene) Gene synonyms aliases	CDF, DIA, HILDA, MLPLI
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulato

Show/Hide all(226)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004325	hsa-miR-199a-5p	ELISA, Luciferase reporter assay	19011087
MIRT001040	hsa-miR-346	ELISA, Luciferase reporter assay	19011087
MIRT001039	hsa-miR-26a-5p	ELISA	19011087
MIRT004326	hsa-miR-125a-5p	ELISA	19011087
MIRT001037	hsa-miR-125b-5p	ELISA	19011087
MIRT006248	hsa-miR-223-3p	Luciferase reporter assay, Western blot	22080513
MIRT018057	hsa-miR-335-5p	Microarray	18185580
MIRT029582	hsa-miR-26b-5p	Microarray	19088304
MIRT038243	hsa-miR-330-5p	CLASH	23622248
MIRT721350	hsa-miR-4650-5p	HITS-CLIP	19536157
MIRT721349	hsa-miR-6733-3p	HITS-CLIP	19536157
MIRT721348	hsa-miR-4645-5p	HITS-CLIP	19536157
MIRT721347	hsa-miR-4673	HITS-CLIP	19536157
MIRT004325	hsa-miR-199a-5p	HITS-CLIP	19536157
MIRT721346	hsa-miR-199b-5p	HITS-CLIP	19536157
MIRT721345	hsa-miR-5193	HITS-CLIP	19536157
MIRT721344	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT721343	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT721342	hsa-miR-4757-5p	HITS-CLIP	19536157
MIRT721341	hsa-miR-6744-3p	HITS-CLIP	19536157
MIRT721340	hsa-miR-4711-3p	HITS-CLIP	19536157
MIRT721339	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT721338	hsa-miR-4279	HITS-CLIP	19536157
MIRT721337	hsa-miR-3180-5p	HITS-CLIP	19536157
MIRT001037	hsa-miR-125b-5p	Microarray, qRT-PCR	25472924
MIRT721350	hsa-miR-4650-5p	PAR-CLIP	26701625
MIRT721350	hsa-miR-4650-5p	PAR-CLIP	26701625
MIRT721350	hsa-miR-4650-5p	PAR-CLIP	26701625
MIRT721350	hsa-miR-4650-5p	PAR-CLIP	26701625
MIRT721350	hsa-miR-4650-5p	HITS-CLIP	28735896
MIRT006248	hsa-miR-223-3p	qRT-PCR, Western blotting	32765695
MIRT006248	hsa-miR-223-3p	qRT-PCR, Western blotting	32765695
MIRT721350	hsa-miR-4650-5p	HITS-CLIP	19536157
MIRT721349	hsa-miR-6733-3p	HITS-CLIP	19536157
MIRT721348	hsa-miR-4645-5p	HITS-CLIP	19536157
MIRT721347	hsa-miR-4673	HITS-CLIP	19536157
MIRT004325	hsa-miR-199a-5p	HITS-CLIP	19536157
MIRT721346	hsa-miR-199b-5p	HITS-CLIP	19536157
MIRT721345	hsa-miR-5193	HITS-CLIP	19536157
MIRT721344	hsa-miR-660-3p	HITS-CLIP	19536157
MIRT721343	hsa-miR-6845-3p	HITS-CLIP	19536157
MIRT721342	hsa-miR-4757-5p	HITS-CLIP	19536157
MIRT721341	hsa-miR-6744-3p	HITS-CLIP	19536157
MIRT721340	hsa-miR-4711-3p	HITS-CLIP	19536157
MIRT721339	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT721338	hsa-miR-4279	HITS-CLIP	19536157
MIRT721337	hsa-miR-3180-5p	HITS-CLIP	19536157
MIRT755871	hsa-miR-1299	Luciferase reporter assay, Western blotting, qRT-PCR, RNA pull down assay	35481460
MIRT1109090	hsa-miR-124	CLIP-seq
MIRT1109091	hsa-miR-181a	CLIP-seq
MIRT1109092	hsa-miR-181b	CLIP-seq
MIRT1109093	hsa-miR-181c	CLIP-seq
MIRT1109094	hsa-miR-181d	CLIP-seq
MIRT1109095	hsa-miR-3125	CLIP-seq
MIRT1109096	hsa-miR-3147	CLIP-seq
MIRT1109097	hsa-miR-3916	CLIP-seq
MIRT1109098	hsa-miR-4262	CLIP-seq
MIRT1109099	hsa-miR-4425	CLIP-seq
MIRT1109100	hsa-miR-450b-3p	CLIP-seq
MIRT1109101	hsa-miR-4520a-3p	CLIP-seq
MIRT1109102	hsa-miR-4753-5p	CLIP-seq
MIRT1109103	hsa-miR-494	CLIP-seq
MIRT1109104	hsa-miR-506	CLIP-seq
MIRT1109105	hsa-miR-548an	CLIP-seq
MIRT1109106	hsa-miR-583	CLIP-seq
MIRT1109107	hsa-miR-769-3p	CLIP-seq
MIRT1109108	hsa-miR-941	CLIP-seq
MIRT1550741	hsa-miR-1224-3p	CLIP-seq
MIRT1109090	hsa-miR-124	CLIP-seq
MIRT1550742	hsa-miR-3936	CLIP-seq
MIRT1550743	hsa-miR-4688	CLIP-seq
MIRT1550744	hsa-miR-4714-3p	CLIP-seq
MIRT1550745	hsa-miR-486-3p	CLIP-seq
MIRT1109104	hsa-miR-506	CLIP-seq
MIRT1550746	hsa-miR-545	CLIP-seq
MIRT1109105	hsa-miR-548an	CLIP-seq
MIRT2030172	hsa-miR-106a	CLIP-seq
MIRT2030173	hsa-miR-106b	CLIP-seq
MIRT2030174	hsa-miR-1184	CLIP-seq
MIRT2030175	hsa-miR-1205	CLIP-seq
MIRT2030176	hsa-miR-1207-5p	CLIP-seq
MIRT2030177	hsa-miR-1254	CLIP-seq
MIRT2030178	hsa-miR-1303	CLIP-seq
MIRT2030179	hsa-miR-150	CLIP-seq
MIRT2030180	hsa-miR-17	CLIP-seq
MIRT1109091	hsa-miR-181a	CLIP-seq
MIRT1109092	hsa-miR-181b	CLIP-seq
MIRT1109093	hsa-miR-181c	CLIP-seq
MIRT1109094	hsa-miR-181d	CLIP-seq
MIRT2030181	hsa-miR-1827	CLIP-seq
MIRT2030182	hsa-miR-1909	CLIP-seq
MIRT2030183	hsa-miR-20a	CLIP-seq
MIRT2030184	hsa-miR-20b	CLIP-seq
MIRT2030185	hsa-miR-223	CLIP-seq
MIRT2030186	hsa-miR-296-3p	CLIP-seq
MIRT2030187	hsa-miR-302a	CLIP-seq
MIRT2030188	hsa-miR-302b	CLIP-seq
MIRT2030189	hsa-miR-302c	CLIP-seq
MIRT2030190	hsa-miR-302d	CLIP-seq
MIRT2030191	hsa-miR-302e	CLIP-seq
MIRT2030192	hsa-miR-3116	CLIP-seq
MIRT1109095	hsa-miR-3125	CLIP-seq
MIRT2030193	hsa-miR-3136-3p	CLIP-seq
MIRT2030194	hsa-miR-3158-5p	CLIP-seq
MIRT2030195	hsa-miR-328	CLIP-seq
MIRT2030196	hsa-miR-3609	CLIP-seq
MIRT2030197	hsa-miR-3614-3p	CLIP-seq
MIRT2030198	hsa-miR-3690	CLIP-seq
MIRT2030199	hsa-miR-3691-3p	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2030201	hsa-miR-372	CLIP-seq
MIRT2030202	hsa-miR-373	CLIP-seq
MIRT1109097	hsa-miR-3916	CLIP-seq
MIRT2030203	hsa-miR-3918	CLIP-seq
MIRT1109098	hsa-miR-4262	CLIP-seq
MIRT2030204	hsa-miR-4300	CLIP-seq
MIRT2030205	hsa-miR-4459	CLIP-seq
MIRT2030206	hsa-miR-4487	CLIP-seq
MIRT2030207	hsa-miR-4512	CLIP-seq
MIRT2030208	hsa-miR-4685-5p	CLIP-seq
MIRT1550743	hsa-miR-4688	CLIP-seq
MIRT2030209	hsa-miR-4690-3p	CLIP-seq
MIRT2030210	hsa-miR-4697-3p	CLIP-seq
MIRT2030211	hsa-miR-4707-5p	CLIP-seq
MIRT2030212	hsa-miR-4731-5p	CLIP-seq
MIRT2030213	hsa-miR-4763-3p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2030215	hsa-miR-4796-3p	CLIP-seq
MIRT1550745	hsa-miR-486-3p	CLIP-seq
MIRT1109103	hsa-miR-494	CLIP-seq
MIRT2030216	hsa-miR-510	CLIP-seq
MIRT2030217	hsa-miR-519d	CLIP-seq
MIRT2030218	hsa-miR-520a-3p	CLIP-seq
MIRT2030219	hsa-miR-520b	CLIP-seq
MIRT2030220	hsa-miR-520c-3p	CLIP-seq
MIRT2030221	hsa-miR-520d-3p	CLIP-seq
MIRT2030222	hsa-miR-520e	CLIP-seq
MIRT2030223	hsa-miR-520f	CLIP-seq
MIRT2030224	hsa-miR-548ah	CLIP-seq
MIRT2030225	hsa-miR-765	CLIP-seq
MIRT2030226	hsa-miR-920	CLIP-seq
MIRT2030227	hsa-miR-93	CLIP-seq
MIRT2030182	hsa-miR-1909	CLIP-seq
MIRT2030193	hsa-miR-3136-3p	CLIP-seq
MIRT2030195	hsa-miR-328	CLIP-seq
MIRT2030196	hsa-miR-3609	CLIP-seq
MIRT2030197	hsa-miR-3614-3p	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2261044	hsa-miR-3921	CLIP-seq
MIRT2261045	hsa-miR-4303	CLIP-seq
MIRT2261046	hsa-miR-4653-5p	CLIP-seq
MIRT1550743	hsa-miR-4688	CLIP-seq
MIRT2030211	hsa-miR-4707-5p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2030224	hsa-miR-548ah	CLIP-seq
MIRT2030197	hsa-miR-3614-3p	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2030174	hsa-miR-1184	CLIP-seq
MIRT2030175	hsa-miR-1205	CLIP-seq
MIRT1109090	hsa-miR-124	CLIP-seq
MIRT2561027	hsa-miR-1245b-3p	CLIP-seq
MIRT2561028	hsa-miR-1297	CLIP-seq
MIRT2561029	hsa-miR-146b-3p	CLIP-seq
MIRT2030182	hsa-miR-1909	CLIP-seq
MIRT2561030	hsa-miR-1915	CLIP-seq
MIRT2561031	hsa-miR-204	CLIP-seq
MIRT2561032	hsa-miR-211	CLIP-seq
MIRT2561033	hsa-miR-26a	CLIP-seq
MIRT2561034	hsa-miR-26b	CLIP-seq
MIRT2561035	hsa-miR-3144-5p	CLIP-seq
MIRT1109096	hsa-miR-3147	CLIP-seq
MIRT2561036	hsa-miR-3157-3p	CLIP-seq
MIRT2030194	hsa-miR-3158-5p	CLIP-seq
MIRT2561037	hsa-miR-3160-3p	CLIP-seq
MIRT2561038	hsa-miR-3173-5p	CLIP-seq
MIRT2561039	hsa-miR-3191	CLIP-seq
MIRT2561040	hsa-miR-3612	CLIP-seq
MIRT2030197	hsa-miR-3614-3p	CLIP-seq
MIRT2561041	hsa-miR-3714	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2561042	hsa-miR-3910	CLIP-seq
MIRT2030203	hsa-miR-3918	CLIP-seq
MIRT2561043	hsa-miR-3925-3p	CLIP-seq
MIRT2561044	hsa-miR-3928	CLIP-seq
MIRT2561045	hsa-miR-4292	CLIP-seq
MIRT2561046	hsa-miR-431	CLIP-seq
MIRT2561047	hsa-miR-432	CLIP-seq
MIRT1109099	hsa-miR-4425	CLIP-seq
MIRT2561048	hsa-miR-4443	CLIP-seq
MIRT2561049	hsa-miR-4457	CLIP-seq
MIRT2561050	hsa-miR-4465	CLIP-seq
MIRT2030206	hsa-miR-4487	CLIP-seq
MIRT1109100	hsa-miR-450b-3p	CLIP-seq
MIRT2030207	hsa-miR-4512	CLIP-seq
MIRT2561051	hsa-miR-4521	CLIP-seq
MIRT2561052	hsa-miR-4522	CLIP-seq
MIRT2561053	hsa-miR-4652-5p	CLIP-seq
MIRT2561054	hsa-miR-4667-5p	CLIP-seq
MIRT2030208	hsa-miR-4685-5p	CLIP-seq
MIRT2561055	hsa-miR-4700-5p	CLIP-seq
MIRT2561056	hsa-miR-4725-5p	CLIP-seq
MIRT2561057	hsa-miR-4726-3p	CLIP-seq
MIRT1109102	hsa-miR-4753-5p	CLIP-seq
MIRT2561058	hsa-miR-4755-5p	CLIP-seq
MIRT2561059	hsa-miR-4780	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq
MIRT2561060	hsa-miR-504	CLIP-seq
MIRT1109104	hsa-miR-506	CLIP-seq
MIRT2561061	hsa-miR-513b	CLIP-seq
MIRT2561062	hsa-miR-548k	CLIP-seq
MIRT2561063	hsa-miR-548n	CLIP-seq
MIRT2561064	hsa-miR-558	CLIP-seq
MIRT2561065	hsa-miR-576-3p	CLIP-seq
MIRT2561066	hsa-miR-623	CLIP-seq
MIRT2561067	hsa-miR-650	CLIP-seq
MIRT1109107	hsa-miR-769-3p	CLIP-seq
MIRT2561068	hsa-miR-873	CLIP-seq
MIRT2561069	hsa-miR-874	CLIP-seq
MIRT2561070	hsa-miR-940	CLIP-seq
MIRT2030200	hsa-miR-371b-5p	CLIP-seq
MIRT2030214	hsa-miR-4793-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
EGR2	Unknown	24007274

Show/Hide all(52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0005102	Function	Signaling receptor binding	IPI	8999038
GO:0005125	Function	Cytokine activity	IBA	21873635
GO:0005125	Function	Cytokine activity	IDA	7957045, 22783022
GO:0005146	Function	Leukemia inhibitory factor receptor binding	IBA	21873635
GO:0005146	Function	Leukemia inhibitory factor receptor binding	IDA	7957045
GO:0005146	Function	Leukemia inhibitory factor receptor binding	IPI	8999038
GO:0005515	Function	Protein binding	IPI	14527405, 16051226, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IC	12643274
GO:0005829	Component	Cytosol	IDA
GO:0006955	Process	Immune response	IEA
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	IEA
GO:0007275	Process	Multicellular organism development	TAS	3143918
GO:0007566	Process	Embryo implantation	IEA
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008083	Function	Growth factor activity	IDA	7957045, 8999038, 12643274
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	7957045, 8999038
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019827	Process	Stem cell population maintenance	IEA
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	7508917
GO:0033141	Process	Positive regulation of peptidyl-serine phosphorylation of STAT protein	IDA	20624457
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	IMP	26723254
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	20624457
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	7508917
GO:0045595	Process	Regulation of cell differentiation	IBA	21873635
GO:0045651	Process	Positive regulation of macrophage differentiation	IDA	7957045
GO:0045835	Process	Negative regulation of meiotic nuclear division	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7508917, 20624457, 22783022, 26723254
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	26723254
GO:0046697	Process	Decidualization	IEA
GO:0046888	Process	Negative regulation of hormone secretion	IDA	7867561
GO:0048286	Process	Lung alveolus development	IEA
GO:0048644	Process	Muscle organ morphogenesis	IEA
GO:0048666	Process	Neuron development	IEA
GO:0048711	Process	Positive regulation of astrocyte differentiation	IEA
GO:0048861	Process	Leukemia inhibitory factor signaling pathway	IBA	21873635
GO:0048861	Process	Leukemia inhibitory factor signaling pathway	IDA	8999038, 12643274
GO:0048863	Process	Stem cell differentiation	IEA
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	7508917
GO:0060426	Process	Lung vasculature development	IEA
GO:0060463	Process	Lung lobe morphogenesis	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0072108	Process	Positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IDA	20624457
GO:0072307	Process	Regulation of metanephric nephron tubule epithelial cell differentiation	IDA	20624457
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	22783022
GO:1901676	Process	Positive regulation of histone H3-K27 acetylation	IDA	22783022
GO:1903025	Process	Regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IEA

MIM	HGNC	e!Ensembl
159540	6596	ENSG00000128342

Protein

UniProt ID

P15018

Protein name

Leukemia inhibitory factor (LIF) (Differentiation-stimulating factor) (D factor) (Melanoma-derived LPL inhibitor) (MLPLI) (Emfilermin)

Protein function

LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimul

PDB

1EMR , 1PVH , 2Q7N , 7N0A , 8D6A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01291	LIF_OSM	43 → 202	LIF / OSM family	Domain

Sequence

MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIAVLAQAF

Sequence length

202

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Signaling pathways regulating pluripotency of stem cells JAK-STAT signaling pathway TNF signaling pathway		Interleukin-10 signaling Interleukin-4 and Interleukin-13 signaling IL-6-type cytokine receptor ligand interactions

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder		14970834	ClinVar
Crohn Disease	Crohn Disease			GWAS
Diabetes	Diabetes			GWAS
Moyamoya Disease	Moyamoya Disease			GWAS
Dementia	Dementia			GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients		GWAS, CBGDA

Show/Hide Text Mining Associations (109)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Habitual	Inhibit	22252755, 25165882
Abortion Habitual	Associate	22698642
Abortion Habitual	Stimulate	25128195
Adenomyosis	Associate	19361790, 32933042
Amyotrophic Lateral Sclerosis	Associate	10951288
Anastomotic Leak	Associate	32307587
Arthritis	Associate	1522240
Arthritis Rheumatoid	Associate	10632674, 1522240, 15642131
Astrocytoma	Associate	11284716
Ataxia Telangiectasia	Associate	31958078
Blast Crisis	Stimulate	1932751
Breast Neoplasms	Associate	21191816, 35280694
Cachexia	Associate	33047901
Carcinogenesis	Associate	38494064
Carcinoma Embryonal	Associate	10480339
Carcinoma Hepatocellular	Associate	2470740, 35313929
Carcinoma Pancreatic Ductal	Associate	36359879
Carcinoma Squamous Cell	Associate	2470740
Cardiomegaly	Stimulate	12796566
Cardiomyopathy Hypertrophic	Stimulate	12796566
Cholangiocarcinoma	Associate	26296968
Chordoma	Associate	28247842
Colorectal Neoplasms	Associate	25726527
Colorectal Neoplasms	Stimulate	34700376
Communicable Diseases	Associate	31061469
Congenital contractural arachnodactyly	Associate	26296968
COVID 19	Associate	39865264
Cystic Fibrosis	Associate	19399182
Delirium	Associate	37156856
Diabetes Mellitus	Associate	22649064
Diabetes Mellitus Type 2	Associate	22649064
Disease	Associate	31339548
Drug Related Side Effects and Adverse Reactions	Inhibit	25027966
Endometrial Neoplasms	Associate	29951943, 38139260
Endometriosis	Associate	19545488, 26056923
Endometriosis	Inhibit	21987111, 28967712
Enterocolitis	Stimulate	33891982
Epstein Barr Virus Infections	Stimulate	16611410
Flushing	Associate	22520363
Focal Facial Dermal Dysplasias	Stimulate	35012573
Glioblastoma	Associate	34987659
Glomerulonephritis IGA	Stimulate	40322064
HIV Infections	Associate	11160152, 17511776
Hyperplasia	Stimulate	10951288
Hyperprolactinemia	Associate	19545488
Hypoxia	Associate	22073257
Hypoxia	Stimulate	25726527
Hypoxia Brain	Stimulate	26229239
Infections	Associate	11665982
Infertility	Associate	18684446, 19545488, 21987111, 22252755, 22520363, 24690239
Infertility	Inhibit	19361790, 28967712
Inflammation	Associate	19399182, 22142222, 25027966, 25484078, 27901489, 28228280, 28247842, 31277141, 32307587, 33891982, 36806964, 40031374, 40133606, 8473500, 9042332
Inflammation	Inhibit	29393372
Inflammation	Stimulate	35280694
Intervertebral Disc Degeneration	Associate	36193061
Keratoconus	Associate	36160033
Leiomyoma	Associate	15193492, 21084396, 32372565
Leiomyoma	Inhibit	32046421
Leiomyomatosis	Associate	32372565
Leukemia	Associate	3128791, 3490886
Leukemia Myeloid	Stimulate	1932751
Leukemia Myeloid	Associate	25726527, 8632998
Leukemia Myeloid Acute	Associate	19913910
Leukemia Myeloid Acute	Inhibit	3490886
Leukodystrophy Metachromatic	Associate	33034697
Lymphoma	Associate	2513320
Medulloblastoma	Associate	10480339, 35159191
Melanoma	Stimulate	25484078
Melanoma	Associate	25885043, 37539569
Melanoma Cutaneous Malignant	Associate	25885043, 40191195
Multiple Myeloma	Associate	39865264, 8145045
Multiple Sclerosis	Associate	19251277, 37219933
Myelodysplastic Syndromes	Associate	19913910
Myelodysplastic Syndromes	Inhibit	25608238
Myositis	Associate	36159840
Neoplasm Metastasis	Associate	25726527, 31142661, 32592689, 35280694, 35654787
Neoplasm Metastasis	Stimulate	26716902
Neoplasms	Associate	10480339, 19470478, 21191816, 25726527, 25942495, 26296968, 26716902, 27901489, 28247842, 28472177, 29444110, 31142661, 33047901, 34416362, 34987659 View all (5 more)
Neoplasms	Inhibit	25885043
Neoplasms Glandular and Epithelial	Associate	28493984
Neuralgia	Associate	35867896
Neuroblastoma	Associate	12153570, 19495417
Osteoarthritis	Associate	10632674, 1522240, 16806998
Pancreatic Neoplasms	Associate	25118635, 33047901, 36359879
Paroxysmal ventricular fibrillation	Associate	30611552
Plasmacytoma	Associate	8145046
Polycystic Ovary Syndrome	Associate	19545488, 21411543, 35551681
Pre Eclampsia	Associate	30833538
Pregnancy Ectopic	Stimulate	8987949
Pregnancy Tubal	Associate	18468598, 25790555
Prostatic Neoplasms	Stimulate	32592689
Prostatic Neoplasms	Associate	35654787, 35821621
Renal Insufficiency	Associate	27304912
Renal Insufficiency	Stimulate	36546418
Rheumatic Diseases	Associate	31861245
Salpingitis	Associate	18468598
Sarcoma Ewing	Associate	1992479
Severe Combined Immunodeficiency	Associate	7537981
Small Cell Lung Carcinoma	Associate	12509453
Squamous Cell Carcinoma of Head and Neck	Stimulate	29444110
Squamous Cell Carcinoma of Head and Neck	Associate	35481460
Status Asthmaticus	Associate	28493984
Stomach Neoplasms	Associate	37945798
Stuve Wiedemann syndrome	Associate	19603067
Thyroid cancer medullary	Associate	12509453, 15572361
Tuberculosis	Associate	26776907
Uterine Cervical Neoplasms	Inhibit	21747640
Uterine Diseases	Associate	35012573
Vitreoretinopathy Proliferative	Associate	39486365

LIF (LIF interleukin 6 family cytokine)