Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3975
Gene name Gene Name - the full gene name approved by the HGNC.
LIM homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LHX1
Synonyms (NCBI Gene) Gene synonyms aliases
LIM-1, LIM1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor important for the development of the renal and urogenital systems. This gene is a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT614583 hsa-miR-141-3p HITS-CLIP 23824327
MIRT614582 hsa-miR-200a-3p HITS-CLIP 23824327
MIRT614581 hsa-miR-302c-5p HITS-CLIP 23824327
MIRT614580 hsa-miR-552-5p HITS-CLIP 23824327
MIRT614583 hsa-miR-141-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601999 6593 ENSG00000273706
Protein
UniProt ID P48742
Protein name LIM/homeobox protein Lhx1 (LIM homeobox protein 1) (Homeobox protein Lim-1) (hLim-1)
Protein function Potential transcription factor. May play a role in early mesoderm formation and later in lateral mesoderm differentiation and neurogenesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 4 59 LIM domain Domain
PF00412 LIM 63 122 LIM domain Domain
PF00046 Homeodomain 181 237 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the brain, thymus, and tonsils. Expressed in samples from patients with chronic myeloid leukemia (CML) and in 58% of acute myeloid leukemia (AML) cell lines. {ECO:0000269|PubMed:9212161}.
Sequence
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFG
TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLS
NS
SVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGP
PSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPS
LPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW
Sequence length 406
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Diabetes mellitus Diabetes Mellitus rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
Unknown
Disease term Disease name Evidence References Source
Dementia Dementia GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 36700567
Cardiovascular Abnormalities Associate 25510704
Chromosome Duplication Associate 25510704
Colorectal Neoplasms Associate 33111631
Developmental Disabilities Associate 36700567
Endometrial Neoplasms Stimulate 36116266
Glioblastoma Associate 38563293
Glioma Associate 22983390, 32857719, 35180817
Glycosuria Renal Associate 22583611
Hypoxia Stimulate 38563293