Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	397
Gene name	Rho GDP dissociation inhibitor beta
Gene symbol	ARHGDIB
Synonyms (NCBI Gene)	D4GDIA2GDID4LYGDILy-GDIRAP1GN1RhoGDI2
Chromosome	12
Chromosome location	12p12.3
Summary	Members of the Rho (or ARH) protein family (see MIM 165390) and other Ras-related small GTP-binding proteins (see MIM 179520) are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The G

227

Show/Hide all (227)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437939	hsa-miR-34a-5p	Western blotLuciferase reporter assay	23349340
MIRT437939	hsa-miR-34a-5p	Western blotLuciferase reporter assay	23349340
MIRT795198	hsa-miR-3688-5p	CLIP-seq
MIRT795199	hsa-miR-4711-5p	CLIP-seq
MIRT2174542	hsa-miR-1207-5p	CLIP-seq
MIRT2174543	hsa-miR-1291	CLIP-seq
MIRT2174544	hsa-miR-134	CLIP-seq
MIRT2174545	hsa-miR-1909	CLIP-seq
MIRT2174546	hsa-miR-3118	CLIP-seq
MIRT2174547	hsa-miR-3128	CLIP-seq
MIRT2174548	hsa-miR-3134	CLIP-seq
MIRT2174549	hsa-miR-3164	CLIP-seq
MIRT2174550	hsa-miR-328	CLIP-seq
MIRT2174551	hsa-miR-383	CLIP-seq
MIRT2174552	hsa-miR-4257	CLIP-seq
MIRT2174553	hsa-miR-4419a	CLIP-seq
MIRT2174554	hsa-miR-4469	CLIP-seq
MIRT2174555	hsa-miR-4501	CLIP-seq
MIRT2174556	hsa-miR-4510	CLIP-seq
MIRT2174557	hsa-miR-4511	CLIP-seq
MIRT2174558	hsa-miR-4534	CLIP-seq
MIRT2174559	hsa-miR-4640-5p	CLIP-seq
MIRT2174560	hsa-miR-4720-5p	CLIP-seq
MIRT2174561	hsa-miR-4726-5p	CLIP-seq
MIRT2174562	hsa-miR-4736	CLIP-seq
MIRT2174563	hsa-miR-4763-3p	CLIP-seq
MIRT2174564	hsa-miR-4764-5p	CLIP-seq
MIRT2174565	hsa-miR-4799-3p	CLIP-seq
MIRT2174566	hsa-miR-4802-5p	CLIP-seq
MIRT2174567	hsa-miR-642a	CLIP-seq
MIRT2174568	hsa-miR-657	CLIP-seq
MIRT2174569	hsa-miR-765	CLIP-seq
MIRT2174542	hsa-miR-1207-5p	CLIP-seq
MIRT2478025	hsa-miR-1243	CLIP-seq
MIRT2478026	hsa-miR-1245	CLIP-seq
MIRT2478027	hsa-miR-1262	CLIP-seq
MIRT2478028	hsa-miR-1273e	CLIP-seq
MIRT2478029	hsa-miR-1273f	CLIP-seq
MIRT2174543	hsa-miR-1291	CLIP-seq
MIRT2478030	hsa-miR-1321	CLIP-seq
MIRT2478031	hsa-miR-143	CLIP-seq
MIRT2478032	hsa-miR-186	CLIP-seq
MIRT2174545	hsa-miR-1909	CLIP-seq
MIRT2478033	hsa-miR-2110	CLIP-seq
MIRT2478034	hsa-miR-219-5p	CLIP-seq
MIRT2478035	hsa-miR-31	CLIP-seq
MIRT2478036	hsa-miR-3123	CLIP-seq
MIRT2478037	hsa-miR-3126-3p	CLIP-seq
MIRT2478038	hsa-miR-3126-5p	CLIP-seq
MIRT2174547	hsa-miR-3128	CLIP-seq
MIRT2174548	hsa-miR-3134	CLIP-seq
MIRT2478039	hsa-miR-3138	CLIP-seq
MIRT2478040	hsa-miR-3153	CLIP-seq
MIRT2478041	hsa-miR-3156-5p	CLIP-seq
MIRT2478042	hsa-miR-3165	CLIP-seq
MIRT2478043	hsa-miR-3176	CLIP-seq
MIRT2478044	hsa-miR-3177-5p	CLIP-seq
MIRT2478045	hsa-miR-3190	CLIP-seq
MIRT2174550	hsa-miR-328	CLIP-seq
MIRT2478046	hsa-miR-342-3p	CLIP-seq
MIRT2478047	hsa-miR-34a	CLIP-seq
MIRT2478048	hsa-miR-34c-5p	CLIP-seq
MIRT2478049	hsa-miR-3606	CLIP-seq
MIRT2478050	hsa-miR-3617	CLIP-seq
MIRT2478051	hsa-miR-3646	CLIP-seq
MIRT2478052	hsa-miR-3654	CLIP-seq
MIRT795198	hsa-miR-3688-5p	CLIP-seq
MIRT2478053	hsa-miR-3691-5p	CLIP-seq
MIRT2174551	hsa-miR-383	CLIP-seq
MIRT2478054	hsa-miR-3922-3p	CLIP-seq
MIRT2478055	hsa-miR-3936	CLIP-seq
MIRT2478056	hsa-miR-3940-3p	CLIP-seq
MIRT2174552	hsa-miR-4257	CLIP-seq
MIRT2478057	hsa-miR-4270	CLIP-seq
MIRT2478058	hsa-miR-4271	CLIP-seq
MIRT2478059	hsa-miR-4273	CLIP-seq
MIRT2478060	hsa-miR-4324	CLIP-seq
MIRT2174553	hsa-miR-4419a	CLIP-seq
MIRT2478061	hsa-miR-4441	CLIP-seq
MIRT2478062	hsa-miR-4445	CLIP-seq
MIRT2174554	hsa-miR-4469	CLIP-seq
MIRT2478063	hsa-miR-449a	CLIP-seq
MIRT2478064	hsa-miR-449b	CLIP-seq
MIRT2174555	hsa-miR-4501	CLIP-seq
MIRT2478065	hsa-miR-4503	CLIP-seq
MIRT2174556	hsa-miR-4510	CLIP-seq
MIRT2174557	hsa-miR-4511	CLIP-seq
MIRT2478066	hsa-miR-4520a-3p	CLIP-seq
MIRT2174558	hsa-miR-4534	CLIP-seq
MIRT2174559	hsa-miR-4640-5p	CLIP-seq
MIRT2478067	hsa-miR-4641	CLIP-seq
MIRT2478068	hsa-miR-4651	CLIP-seq
MIRT2478069	hsa-miR-4658	CLIP-seq
MIRT2478070	hsa-miR-4668-5p	CLIP-seq
MIRT2478071	hsa-miR-4677-5p	CLIP-seq
MIRT2478072	hsa-miR-4701-3p	CLIP-seq
MIRT2478073	hsa-miR-4708-5p	CLIP-seq
MIRT2478074	hsa-miR-4709-3p	CLIP-seq
MIRT795199	hsa-miR-4711-5p	CLIP-seq
MIRT2478075	hsa-miR-4719	CLIP-seq
MIRT2174560	hsa-miR-4720-5p	CLIP-seq
MIRT2478076	hsa-miR-4725-3p	CLIP-seq
MIRT2174561	hsa-miR-4726-5p	CLIP-seq
MIRT2174562	hsa-miR-4736	CLIP-seq
MIRT2478077	hsa-miR-4739	CLIP-seq
MIRT2478078	hsa-miR-4756-5p	CLIP-seq
MIRT2478079	hsa-miR-4757-5p	CLIP-seq
MIRT2478080	hsa-miR-4758-5p	CLIP-seq
MIRT2174563	hsa-miR-4763-3p	CLIP-seq
MIRT2174564	hsa-miR-4764-5p	CLIP-seq
MIRT2478081	hsa-miR-4765	CLIP-seq
MIRT2478082	hsa-miR-4770	CLIP-seq
MIRT2478083	hsa-miR-4779	CLIP-seq
MIRT2478084	hsa-miR-4782-3p	CLIP-seq
MIRT2174565	hsa-miR-4799-3p	CLIP-seq
MIRT2478085	hsa-miR-4800-5p	CLIP-seq
MIRT2174566	hsa-miR-4802-5p	CLIP-seq
MIRT2478086	hsa-miR-491-5p	CLIP-seq
MIRT2478087	hsa-miR-508-3p	CLIP-seq
MIRT2478088	hsa-miR-555	CLIP-seq
MIRT2478089	hsa-miR-606	CLIP-seq
MIRT2478090	hsa-miR-608	CLIP-seq
MIRT2478091	hsa-miR-641	CLIP-seq
MIRT2174567	hsa-miR-642a	CLIP-seq
MIRT2478092	hsa-miR-645	CLIP-seq
MIRT2478093	hsa-miR-653	CLIP-seq
MIRT2174568	hsa-miR-657	CLIP-seq
MIRT2478094	hsa-miR-7	CLIP-seq
MIRT2478095	hsa-miR-711	CLIP-seq
MIRT2174569	hsa-miR-765	CLIP-seq
MIRT2478096	hsa-miR-921	CLIP-seq
MIRT2174542	hsa-miR-1207-5p	CLIP-seq
MIRT2478026	hsa-miR-1245	CLIP-seq
MIRT2478027	hsa-miR-1262	CLIP-seq
MIRT2478028	hsa-miR-1273e	CLIP-seq
MIRT2478029	hsa-miR-1273f	CLIP-seq
MIRT2174543	hsa-miR-1291	CLIP-seq
MIRT2478030	hsa-miR-1321	CLIP-seq
MIRT2174544	hsa-miR-134	CLIP-seq
MIRT2478031	hsa-miR-143	CLIP-seq
MIRT2478032	hsa-miR-186	CLIP-seq
MIRT2174545	hsa-miR-1909	CLIP-seq
MIRT2478033	hsa-miR-2110	CLIP-seq
MIRT2478034	hsa-miR-219-5p	CLIP-seq
MIRT2478035	hsa-miR-31	CLIP-seq
MIRT2174546	hsa-miR-3118	CLIP-seq
MIRT2478036	hsa-miR-3123	CLIP-seq
MIRT2478037	hsa-miR-3126-3p	CLIP-seq
MIRT2478038	hsa-miR-3126-5p	CLIP-seq
MIRT2174547	hsa-miR-3128	CLIP-seq
MIRT2174548	hsa-miR-3134	CLIP-seq
MIRT2478039	hsa-miR-3138	CLIP-seq
MIRT2478040	hsa-miR-3153	CLIP-seq
MIRT2478041	hsa-miR-3156-5p	CLIP-seq
MIRT2174549	hsa-miR-3164	CLIP-seq
MIRT2478042	hsa-miR-3165	CLIP-seq
MIRT2478043	hsa-miR-3176	CLIP-seq
MIRT2478044	hsa-miR-3177-5p	CLIP-seq
MIRT2478045	hsa-miR-3190	CLIP-seq
MIRT2174550	hsa-miR-328	CLIP-seq
MIRT2478046	hsa-miR-342-3p	CLIP-seq
MIRT2478047	hsa-miR-34a	CLIP-seq
MIRT2478048	hsa-miR-34c-5p	CLIP-seq
MIRT2478049	hsa-miR-3606	CLIP-seq
MIRT2478050	hsa-miR-3617	CLIP-seq
MIRT2478051	hsa-miR-3646	CLIP-seq
MIRT795198	hsa-miR-3688-5p	CLIP-seq
MIRT2478053	hsa-miR-3691-5p	CLIP-seq
MIRT2174551	hsa-miR-383	CLIP-seq
MIRT2478054	hsa-miR-3922-3p	CLIP-seq
MIRT2478055	hsa-miR-3936	CLIP-seq
MIRT2478056	hsa-miR-3940-3p	CLIP-seq
MIRT2174552	hsa-miR-4257	CLIP-seq
MIRT2478057	hsa-miR-4270	CLIP-seq
MIRT2478058	hsa-miR-4271	CLIP-seq
MIRT2478059	hsa-miR-4273	CLIP-seq
MIRT2478060	hsa-miR-4324	CLIP-seq
MIRT2174553	hsa-miR-4419a	CLIP-seq
MIRT2478061	hsa-miR-4441	CLIP-seq
MIRT2478062	hsa-miR-4445	CLIP-seq
MIRT2174554	hsa-miR-4469	CLIP-seq
MIRT2478063	hsa-miR-449a	CLIP-seq
MIRT2478064	hsa-miR-449b	CLIP-seq
MIRT2174555	hsa-miR-4501	CLIP-seq
MIRT2478065	hsa-miR-4503	CLIP-seq
MIRT2174556	hsa-miR-4510	CLIP-seq
MIRT2174557	hsa-miR-4511	CLIP-seq
MIRT2478066	hsa-miR-4520a-3p	CLIP-seq
MIRT2174558	hsa-miR-4534	CLIP-seq
MIRT2478067	hsa-miR-4641	CLIP-seq
MIRT2478068	hsa-miR-4651	CLIP-seq
MIRT2478069	hsa-miR-4658	CLIP-seq
MIRT2478070	hsa-miR-4668-5p	CLIP-seq
MIRT2478071	hsa-miR-4677-5p	CLIP-seq
MIRT2478072	hsa-miR-4701-3p	CLIP-seq
MIRT2478073	hsa-miR-4708-5p	CLIP-seq
MIRT2478074	hsa-miR-4709-3p	CLIP-seq
MIRT795199	hsa-miR-4711-5p	CLIP-seq
MIRT2478075	hsa-miR-4719	CLIP-seq
MIRT2174560	hsa-miR-4720-5p	CLIP-seq
MIRT2478076	hsa-miR-4725-3p	CLIP-seq
MIRT2174562	hsa-miR-4736	CLIP-seq
MIRT2478077	hsa-miR-4739	CLIP-seq
MIRT2478078	hsa-miR-4756-5p	CLIP-seq
MIRT2478079	hsa-miR-4757-5p	CLIP-seq
MIRT2478080	hsa-miR-4758-5p	CLIP-seq
MIRT2174563	hsa-miR-4763-3p	CLIP-seq
MIRT2174564	hsa-miR-4764-5p	CLIP-seq
MIRT2478081	hsa-miR-4765	CLIP-seq
MIRT2478082	hsa-miR-4770	CLIP-seq
MIRT2478083	hsa-miR-4779	CLIP-seq
MIRT2478084	hsa-miR-4782-3p	CLIP-seq
MIRT2174565	hsa-miR-4799-3p	CLIP-seq
MIRT2478085	hsa-miR-4800-5p	CLIP-seq
MIRT2174566	hsa-miR-4802-5p	CLIP-seq
MIRT2478086	hsa-miR-491-5p	CLIP-seq
MIRT2478087	hsa-miR-508-3p	CLIP-seq
MIRT2478088	hsa-miR-555	CLIP-seq
MIRT2478090	hsa-miR-608	CLIP-seq
MIRT2478091	hsa-miR-641	CLIP-seq
MIRT2174567	hsa-miR-642a	CLIP-seq
MIRT2478093	hsa-miR-653	CLIP-seq
MIRT2174568	hsa-miR-657	CLIP-seq
MIRT2478094	hsa-miR-7	CLIP-seq
MIRT2478095	hsa-miR-711	CLIP-seq
MIRT2174569	hsa-miR-765	CLIP-seq
MIRT2478096	hsa-miR-921	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IMP	24554735
GO:0005094	Function	Rho GDP-dissociation inhibitor activity	IBA
GO:0005094	Function	Rho GDP-dissociation inhibitor activity	IDA	7512369, 8356058
GO:0005094	Function	Rho GDP-dissociation inhibitor activity	IEA
GO:0005094	Function	Rho GDP-dissociation inhibitor activity	TAS	8262133
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	7512369, 32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	10802295
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	TAS	16130169
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0016020	Component	Membrane	IBA
GO:0031267	Function	Small GTPase binding	IDA	7512369
GO:0031410	Component	Cytoplasmic vesicle	TAS	9113980
GO:0035023	Process	Regulation of Rho protein signal transduction	IDA	7512369
GO:0035023	Process	Regulation of Rho protein signal transduction	IMP	8262133
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0071461	Process	Cellular response to redox state	IEA
GO:1901164	Process	Negative regulation of trophoblast cell migration	IDA	24554735

MIM	HGNC	e!Ensembl
602843	679	ENSG00000111348

P52566

Protein name

Rho GDP-dissociation inhibitor 2 (Rho GDI 2) (Ly-GDI) (Rho-GDI beta)

Protein function

Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them (PubMed:7512369, PubMed:8356058). Regulates reorganization of the actin cytoskeleton mediated

PDB

1DS6 , 5H1D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02115	Rho_GDI	8 → 198	RHO protein GDP dissociation inhibitor	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in bone marrow, thymus and spleen. {ECO:0000269|PubMed:8356058}.

Sequence

MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVT
DPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIV
SGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTD
DDKQDHLSWEWNLSIKKEWTE

Sequence length

201

Interactions

View interactions

	KEGG		Reactome
	Neurotrophin signaling pathway Vasopressin-regulated water reabsorption		Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HIV INFECTIONS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acute Lung Injury	Associate	37700323	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Associate	10539886	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Associate	10539886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	19451088, 23206989, 32176626	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	27832197	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cell Transformation Neoplastic	Associate	24721928	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Associate	23206989	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	34184409	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease 0 Muscle	Associate	10539886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	17897297	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	10539886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	16081408	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	25266803, 25802847	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	31262358	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	32176626	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell Marginal Zone	Stimulate	28404907	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	19321744, 22469974	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	24721928	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	28846829	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	20375790	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	22469974, 23206989, 24185104, 24721928, 32176626, 34184409, 37635218	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	25266803, 34437633	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	10779444	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	20375790, 22249249	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	23206989	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Stimulate	28404907	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Associate	23206989	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	24185104, 24721928	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	19321744, 30635654	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Stimulate	28846829	★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGDIB (Rho GDP dissociation inhibitor beta)