Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID	3965
Gene name	Galectin 9
Gene symbol	LGALS9
Synonyms (NCBI Gene)	HUATLGALS9A
Chromosome	17
Chromosome location	17q11.2
Summary	The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin`s disease tissue and might participate in

Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017245	hsa-miR-335-5p	Microarray	18185580
MIRT731478	hsa-miR-22-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	26239725
MIRT731478	hsa-miR-22-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	26239725
MIRT1108316	hsa-miR-3199	CLIP-seq
MIRT1108317	hsa-miR-3675-5p	CLIP-seq
MIRT1108318	hsa-miR-3689a-3p	CLIP-seq
MIRT1108319	hsa-miR-3689c	CLIP-seq
MIRT1108320	hsa-miR-4283	CLIP-seq
MIRT1108321	hsa-miR-4489	CLIP-seq
MIRT1108322	hsa-miR-4652-5p	CLIP-seq
MIRT1108323	hsa-miR-4728-5p	CLIP-seq
MIRT1108324	hsa-miR-4740-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
HDAC3	Unknown	22027828

Show/Hide all (79)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002519	Process	Natural killer cell tolerance induction	IMP	25578313
GO:0002826	Process	Negative regulation of T-helper 1 type immune response	IDA	16286920
GO:0002826	Process	Negative regulation of T-helper 1 type immune response	IDA	16286920
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005534	Function	Galactose binding	TAS	9045665
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	20209097
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	23242525
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	23242525
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IDA	23817958
GO:0007565	Process	Female pregnancy	IDA	23242525
GO:0010628	Process	Positive regulation of gene expression	IBA
GO:0010628	Process	Positive regulation of gene expression	IDA	16116184
GO:0010629	Process	Negative regulation of gene expression	IDA	23408620
GO:0010629	Process	Negative regulation of gene expression	IMP	25578313
GO:0016936	Function	Galactoside binding	IBA
GO:0019899	Function	Enzyme binding	IPI	21670307
GO:0030246	Function	Carbohydrate binding	IBA
GO:0030246	Function	Carbohydrate binding	IDA	18977853
GO:0030246	Function	Carbohydrate binding	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231
GO:0032496	Process	Response to lipopolysaccharide	IMP	25578313
GO:0032673	Process	Regulation of interleukin-4 production	IDA	16116184
GO:0032674	Process	Regulation of interleukin-5 production	IDA	16116184
GO:0032682	Process	Negative regulation of chemokine production	IMP	25754930
GO:0032689	Process	Negative regulation of type II interferon production	IBA
GO:0032689	Process	Negative regulation of type II interferon production	IDA	23408620
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IMP	25578313
GO:0032729	Process	Positive regulation of type II interferon production	IDA	20209097
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	20209097
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	16116184, 20209097
GO:0032735	Process	Positive regulation of interleukin-12 production	IMP	16116184, 25754930
GO:0032736	Process	Positive regulation of interleukin-13 production	IDA	20209097
GO:0032753	Process	Positive regulation of interleukin-4 production	IDA	20209097
GO:0032753	Process	Positive regulation of interleukin-4 production	IMP	25578313
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	24465902
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	24465902
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	20209097
GO:0032834	Process	Positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation involved in immune response	IDA	20209097
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IDA	16116184
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	16116184
GO:0038066	Process	P38MAPK cascade	IDA	16116184
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0043305	Process	Negative regulation of mast cell degranulation	IMP	24465902
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	23408620
GO:0046007	Process	Negative regulation of activated T cell proliferation	IMP	23817958
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	21670307
GO:0048018	Function	Receptor ligand activity	IDA	16286920
GO:0048030	Function	Disaccharide binding	IMP	16116184
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	25754930
GO:0060135	Process	Maternal process involved in female pregnancy	IDA	25578313
GO:0070241	Process	Positive regulation of activated T cell autonomous cell death	IDA	20209097
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	16116184
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	24465902, 25754930
GO:0070492	Function	Oligosaccharide binding	IDA	21670307
GO:0070555	Process	Response to interleukin-1	IDA	23817958
GO:0071346	Process	Cellular response to type II interferon	IDA	23817958
GO:0071636	Process	Positive regulation of transforming growth factor beta production	IDA	20209097
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IMP	24465902
GO:0097029	Process	Mature conventional dendritic cell differentiation	IMP	25754930
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:1900744	Process	Regulation of p38MAPK cascade	IMP	24465902
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	25754930
GO:2000406	Process	Positive regulation of T cell migration	IDA	21670307
GO:2000406	Process	Positive regulation of T cell migration	IDA	21670307
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IMP	25754930
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IBA
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IDA	20209097
GO:2000563	Process	Positive regulation of CD4-positive, alpha-beta T cell proliferation	IDA	16116184
GO:2000670	Process	Positive regulation of dendritic cell apoptotic process	IDA	16116184
GO:2001190	Process	Positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IDA	16116184
GO:2001200	Process	Positive regulation of dendritic cell differentiation	IMP	16116184

MIM	HGNC	e!Ensembl
601879	6570	ENSG00000168961

O00182

Protein name

Galectin-9 (Gal-9) (Ecalectin) (Tumor antigen HOM-HD-21)

Protein function

Binds galactosides (PubMed:18005988). Has high affinity for the Forssman pentasaccharide (PubMed:18005988). Ligand for HAVCR2/TIM3 (PubMed:16286920). Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death (PubMed:16286920). Also stimul

PDB

2EAK , 2EAL , 2YY1 , 2ZHK , 2ZHL , 2ZHM , 2ZHN , 3LSD , 3LSE , 3NV1 , 3NV2 , 3NV3 , 3NV4 , 3WLU , 3WV6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00337	Gal-bind_lectin	16 → 147	Galactoside-binding lectin	Domain
PF00337	Gal-bind_lectin	226 → 355	Galactoside-binding lectin	Domain

Tissue specificity

TISSUE SPECIFICITY: Peripheral blood leukocytes and lymphatic tissues. Expressed in lung, liver, breast and kidney with higher levels in tumor endothelial cells than normal endothelium (at protein level) (PubMed:24333696). Expressed in trophoblast cells i

Sequence

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAF
HFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV
QYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQK
PPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKS
ILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPF
VRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Sequence length

355

Interactions

View interactions

LGALS9 (galectin 9)