Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3959
Gene name Gene Name - the full gene name approved by the HGNC.
Galectin 3 binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LGALS3BP
Synonyms (NCBI Gene) Gene synonyms aliases
90K, BTBD17B, CyCAP, M2BP, MAC-2-BP, TANGO10B, gp90
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency viru
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007309 hsa-miR-596 Luciferase reporter assay, Western blot 23233740
MIRT007309 hsa-miR-596 Luciferase reporter assay, Western blot 23233740
MIRT024048 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT025918 hsa-miR-7-5p Microarray 19073608
MIRT046598 hsa-miR-222-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
CREB5 Repression 21132541
STAT3 Repression 18594176
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005044 Function Scavenger receptor activity TAS 8390986
GO:0005515 Function Protein binding IPI 22939624, 26618866, 28514442, 29162697, 29924966, 30833792, 32814053, 33961781, 38825040
GO:0005576 Component Extracellular region HDA 27068509
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600626 6564 ENSG00000108679
Protein
UniProt ID Q08380
Protein name Galectin-3-binding protein (Basement membrane autoantigen p105) (Lectin galactoside-binding soluble 3-binding protein) (Mac-2-binding protein) (MAC2BP) (Mac-2 BP) (Tumor-associated antigen 90K)
Protein function Promotes integrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells.
PDB 1BY2 , 6GFB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00530 SRCR 27 124 Scavenger receptor cysteine-rich domain Domain
PF07707 BACK 260 360 BTB And C-terminal Kelch Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Detected in body fluids such as semen, milk, serum, tears, saliva and urine. Expressed by keratinocytes and fibroblasts. {ECO:0000269|PubMed:8034587, ECO:0000269|PubMed:8390986, ECO:0000269|PubMed:8757764}.
Sequence
MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASV
VCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAG
VVCT
NETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANL
EAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLASAYGARQLQ
GYCASLFAILLPQDPSFQMPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPSVP
TDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPMMLPEELFELQ

FNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTSPTWSAFVTD
SSWSARKSQLVYQSRRGPLVKYSSDYFQAPSDYRYYPYQSFQTPQHPSFLFQDKRVSWSL
VYLPTIQSCWNYGFSCSSDELPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGW
KAAIPSALDTNSSKSTSSFPCPAGHFNGFRTVIRPFYLTNSSGVD
Sequence length 585
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Platelet degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 33801801
Alzheimer Disease Associate 31996371
Arthritis Rheumatoid Associate 11145021, 14558084
Atherosclerosis Associate 30530049
Autoimmune Diseases Associate 21515679
Azoospermia Associate 23427166
Biliary Tract Neoplasms Stimulate 15378479
Bone Diseases Associate 14558084
Brain Ischemia Associate 30530049
Breast Neoplasms Associate 18729497, 19522481, 22934887, 22970241, 23181716