Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3959
Gene name Gene Name - the full gene name approved by the HGNC.	Galectin 3 binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LGALS3BP
Synonyms (NCBI Gene) Gene synonyms aliases	90K, BTBD17B, CyCAP, M2BP, MAC-2-BP, TANGO10B, gp90
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency viru

Show/Hide all(170)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007309	hsa-miR-596	Luciferase reporter assay, Western blot	23233740
MIRT007309	hsa-miR-596	Luciferase reporter assay, Western blot	23233740
MIRT024048	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT025918	hsa-miR-7-5p	Microarray	19073608
MIRT046598	hsa-miR-222-3p	CLASH	23622248
MIRT039290	hsa-miR-671-5p	CLASH	23622248
MIRT038953	hsa-miR-26b-3p	CLASH	23622248
MIRT038443	hsa-miR-296-3p	CLASH	23622248
MIRT052728	hsa-miR-1260b	CLASH	23622248
MIRT451324	hsa-miR-3974	PAR-CLIP	23592263
MIRT451323	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT451322	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT451321	hsa-miR-3125	PAR-CLIP	23592263
MIRT451320	hsa-miR-3916	PAR-CLIP	23592263
MIRT451319	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT007309	hsa-miR-596	PAR-CLIP	23592263
MIRT451318	hsa-miR-4476	PAR-CLIP	23592263
MIRT451317	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT451316	hsa-miR-4779	PAR-CLIP	23592263
MIRT451315	hsa-miR-4317	PAR-CLIP	23592263
MIRT451314	hsa-miR-151a-5p	PAR-CLIP	23592263
MIRT451313	hsa-miR-151b	PAR-CLIP	23592263
MIRT451312	hsa-miR-17-3p	PAR-CLIP	23592263
MIRT451311	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT451310	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT451309	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT451308	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT039290	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT451307	hsa-miR-4533	PAR-CLIP	23592263
MIRT451306	hsa-miR-6827-5p	PAR-CLIP	23592263
MIRT451305	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT451304	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT451303	hsa-miR-616-3p	PAR-CLIP	23592263
MIRT451302	hsa-miR-1273h-3p	PAR-CLIP	23592263
MIRT451301	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT451300	hsa-miR-3158-5p	PAR-CLIP	23592263
MIRT451324	hsa-miR-3974	PAR-CLIP	27292025
MIRT451310	hsa-miR-493-3p	PAR-CLIP	27292025
MIRT451303	hsa-miR-616-3p	PAR-CLIP	27292025
MIRT451324	hsa-miR-3974	PAR-CLIP	23592263
MIRT451323	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT451322	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT451321	hsa-miR-3125	PAR-CLIP	23592263
MIRT451320	hsa-miR-3916	PAR-CLIP	23592263
MIRT451319	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT007309	hsa-miR-596	PAR-CLIP	23592263
MIRT451318	hsa-miR-4476	PAR-CLIP	23592263
MIRT451317	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT451316	hsa-miR-4779	PAR-CLIP	23592263
MIRT451315	hsa-miR-4317	PAR-CLIP	23592263
MIRT451314	hsa-miR-151a-5p	PAR-CLIP	23592263
MIRT451313	hsa-miR-151b	PAR-CLIP	23592263
MIRT451312	hsa-miR-17-3p	PAR-CLIP	23592263
MIRT451311	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT451310	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT451309	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT451308	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT039290	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT451307	hsa-miR-4533	PAR-CLIP	23592263
MIRT451306	hsa-miR-6827-5p	PAR-CLIP	23592263
MIRT451305	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT451304	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT451303	hsa-miR-616-3p	PAR-CLIP	23592263
MIRT451302	hsa-miR-1273h-3p	PAR-CLIP	23592263
MIRT451301	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT451300	hsa-miR-3158-5p	PAR-CLIP	23592263
MIRT1550729	hsa-miR-151-5p	CLIP-seq
MIRT2029919	hsa-miR-4743	CLIP-seq
MIRT2029920	hsa-miR-493	CLIP-seq
MIRT2029921	hsa-miR-616	CLIP-seq
MIRT2029922	hsa-miR-653	CLIP-seq
MIRT2260784	hsa-miR-4261	CLIP-seq
MIRT2260785	hsa-miR-619	CLIP-seq
MIRT2260786	hsa-miR-875-3p	CLIP-seq
MIRT2438339	hsa-miR-3150a-5p	CLIP-seq
MIRT2438340	hsa-miR-3150b-5p	CLIP-seq
MIRT2438341	hsa-miR-3151	CLIP-seq
MIRT2438342	hsa-miR-4447	CLIP-seq
MIRT2438343	hsa-miR-4472	CLIP-seq
MIRT2438344	hsa-miR-4525	CLIP-seq
MIRT2438345	hsa-miR-4675	CLIP-seq
MIRT2438346	hsa-miR-4713-3p	CLIP-seq
MIRT2438347	hsa-miR-4741	CLIP-seq
MIRT2438348	hsa-miR-491-5p	CLIP-seq
MIRT2560778	hsa-miR-127-5p	CLIP-seq
MIRT2560779	hsa-miR-1294	CLIP-seq
MIRT2560780	hsa-miR-145	CLIP-seq
MIRT2560781	hsa-miR-146a	CLIP-seq
MIRT2560782	hsa-miR-146b-5p	CLIP-seq
MIRT2438339	hsa-miR-3150a-5p	CLIP-seq
MIRT2438340	hsa-miR-3150b-5p	CLIP-seq
MIRT2438341	hsa-miR-3151	CLIP-seq
MIRT2560783	hsa-miR-3165	CLIP-seq
MIRT2560784	hsa-miR-3190	CLIP-seq
MIRT2560785	hsa-miR-339-3p	CLIP-seq
MIRT2560786	hsa-miR-3681	CLIP-seq
MIRT2560787	hsa-miR-3934	CLIP-seq
MIRT2260784	hsa-miR-4261	CLIP-seq
MIRT2438342	hsa-miR-4447	CLIP-seq
MIRT2438343	hsa-miR-4472	CLIP-seq
MIRT2438344	hsa-miR-4525	CLIP-seq
MIRT2560788	hsa-miR-4635	CLIP-seq
MIRT2560789	hsa-miR-4663	CLIP-seq
MIRT2438345	hsa-miR-4675	CLIP-seq
MIRT2560790	hsa-miR-4710	CLIP-seq
MIRT2560791	hsa-miR-4712-5p	CLIP-seq
MIRT2438346	hsa-miR-4713-3p	CLIP-seq
MIRT2560792	hsa-miR-4738-3p	CLIP-seq
MIRT2438347	hsa-miR-4741	CLIP-seq
MIRT2029919	hsa-miR-4743	CLIP-seq
MIRT2560793	hsa-miR-4792	CLIP-seq
MIRT2560794	hsa-miR-4800-5p	CLIP-seq
MIRT2438348	hsa-miR-491-5p	CLIP-seq
MIRT2029920	hsa-miR-493	CLIP-seq
MIRT2560795	hsa-miR-526b	CLIP-seq
MIRT2560796	hsa-miR-541	CLIP-seq
MIRT2560797	hsa-miR-578	CLIP-seq
MIRT2560798	hsa-miR-582-3p	CLIP-seq
MIRT2029921	hsa-miR-616	CLIP-seq
MIRT2260785	hsa-miR-619	CLIP-seq
MIRT2029922	hsa-miR-653	CLIP-seq
MIRT2560799	hsa-miR-654-5p	CLIP-seq
MIRT2560800	hsa-miR-711	CLIP-seq
MIRT2560801	hsa-miR-770-5p	CLIP-seq
MIRT2260786	hsa-miR-875-3p	CLIP-seq
MIRT2683877	hsa-miR-1252	CLIP-seq
MIRT2683878	hsa-miR-1273	CLIP-seq
MIRT2560778	hsa-miR-127-5p	CLIP-seq
MIRT2560779	hsa-miR-1294	CLIP-seq
MIRT2560780	hsa-miR-145	CLIP-seq
MIRT2560781	hsa-miR-146a	CLIP-seq
MIRT2560782	hsa-miR-146b-5p	CLIP-seq
MIRT1550729	hsa-miR-151-5p	CLIP-seq
MIRT2438339	hsa-miR-3150a-5p	CLIP-seq
MIRT2438340	hsa-miR-3150b-5p	CLIP-seq
MIRT2438341	hsa-miR-3151	CLIP-seq
MIRT2560783	hsa-miR-3165	CLIP-seq
MIRT2560784	hsa-miR-3190	CLIP-seq
MIRT2560785	hsa-miR-339-3p	CLIP-seq
MIRT2560786	hsa-miR-3681	CLIP-seq
MIRT2560787	hsa-miR-3934	CLIP-seq
MIRT2260784	hsa-miR-4261	CLIP-seq
MIRT2438342	hsa-miR-4447	CLIP-seq
MIRT2438343	hsa-miR-4472	CLIP-seq
MIRT2438344	hsa-miR-4525	CLIP-seq
MIRT2560788	hsa-miR-4635	CLIP-seq
MIRT2560789	hsa-miR-4663	CLIP-seq
MIRT2438345	hsa-miR-4675	CLIP-seq
MIRT2560790	hsa-miR-4710	CLIP-seq
MIRT2560791	hsa-miR-4712-5p	CLIP-seq
MIRT2438346	hsa-miR-4713-3p	CLIP-seq
MIRT2560792	hsa-miR-4738-3p	CLIP-seq
MIRT2438347	hsa-miR-4741	CLIP-seq
MIRT2029919	hsa-miR-4743	CLIP-seq
MIRT2560793	hsa-miR-4792	CLIP-seq
MIRT2560794	hsa-miR-4800-5p	CLIP-seq
MIRT2438348	hsa-miR-491-5p	CLIP-seq
MIRT2029920	hsa-miR-493	CLIP-seq
MIRT2560795	hsa-miR-526b	CLIP-seq
MIRT2560796	hsa-miR-541	CLIP-seq
MIRT2560797	hsa-miR-578	CLIP-seq
MIRT2560798	hsa-miR-582-3p	CLIP-seq
MIRT2029921	hsa-miR-616	CLIP-seq
MIRT2260785	hsa-miR-619	CLIP-seq
MIRT2029922	hsa-miR-653	CLIP-seq
MIRT2560799	hsa-miR-654-5p	CLIP-seq
MIRT2560800	hsa-miR-711	CLIP-seq
MIRT2560801	hsa-miR-770-5p	CLIP-seq
MIRT2260786	hsa-miR-875-3p	CLIP-seq
MIRT2683879	hsa-miR-939	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CREB5	Repression	21132541
STAT3	Repression	18594176

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005044	Function	Scavenger receptor activity	TAS	8390986
GO:0005515	Function	Protein binding	IPI	22939624, 26618866, 28514442, 29162697, 29924966, 30833792, 32814053, 33961781, 38825040
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	25645918
GO:0005615	Component	Extracellular space	TAS	8390986
GO:0006968	Process	Cellular defense response	TAS	8034587
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	TAS	8390986
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0031089	Component	Platelet dense granule lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 21362503, 23533145
GO:0072562	Component	Blood microparticle	HDA	22516433

MIM	HGNC	e!Ensembl
600626	6564	ENSG00000108679

Protein

UniProt ID

Q08380

Protein name

Galectin-3-binding protein (Basement membrane autoantigen p105) (Lectin galactoside-binding soluble 3-binding protein) (Mac-2-binding protein) (MAC2BP) (Mac-2 BP) (Tumor-associated antigen 90K)

Protein function

Promotes integrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells.

PDB

1BY2 , 6GFB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00530	SRCR	27 → 124	Scavenger receptor cysteine-rich domain	Domain
PF07707	BACK	260 → 360	BTB And C-terminal Kelch	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Detected in body fluids such as semen, milk, serum, tears, saliva and urine. Expressed by keratinocytes and fibroblasts. {ECO:0000269|PubMed:8034587, ECO:0000269|PubMed:8390986, ECO:0000269|PubMed:8757764}.

Sequence

MTPPRLFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASV
VCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAG
VVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANL
EAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLASAYGARQLQ
GYCASLFAILLPQDPSFQMPLDLYAYAVATGDALLEKLCLQFLAWNFEALTQAEAWPSVP
TDLLQLLLPRSDLAVPSELALLKAVDTWSWGERASHEEVEGLVEKIRFPMMLPEELFELQ
FNLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTSPTWSAFVTD
SSWSARKSQLVYQSRRGPLVKYSSDYFQAPSDYRYYPYQSFQTPQHPSFLFQDKRVSWSL
VYLPTIQSCWNYGFSCSSDELPVLGLTKSGGSDRTIAYENKALMLCEGLFVADVTDFEGW
KAAIPSALDTNSSKSTSSFPCPAGHFNGFRTVIRPFYLTNSSGVD

Sequence length

585

Interactions

View interactions

	Reactome
			Platelet degranulation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioblastoma	Glioblastoma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (59)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Kidney Injury	Associate	33801801
Alzheimer Disease	Associate	31996371
Arthritis Rheumatoid	Associate	11145021, 14558084
Atherosclerosis	Associate	30530049
Autoimmune Diseases	Associate	21515679
Azoospermia	Associate	23427166
Biliary Tract Neoplasms	Stimulate	15378479
Bone Diseases	Associate	14558084
Brain Ischemia	Associate	30530049
Breast Neoplasms	Associate	18729497, 19522481, 22934887, 22970241, 23181716
Breast Neoplasms	Stimulate	21515679, 35471994
Carcinoma Ductal	Associate	11815981
Carcinoma Hepatocellular	Associate	26070204, 28550167, 30381417
Carcinoma Pancreatic Ductal	Associate	24471499, 29045505
Carcinoma Pancreatic Ductal	Stimulate	28627758
Carotid Stenosis	Associate	30530049
Cholangiocarcinoma	Associate	31136099
Choriocarcinoma	Associate	35038949
Colorectal Neoplasms	Associate	21515679, 39947398
Coronary Artery Disease	Associate	30530049
COVID 19	Associate	34232570
Death	Associate	30821848
Depressive Disorder	Associate	36982982
Dermatomyositis	Stimulate	36661295
Esophageal Squamous Cell Carcinoma	Associate	20686364
Fibrosis	Associate	20186066, 34786828
Glioblastoma	Stimulate	30848102
Hepatitis C	Stimulate	21515679
Hepatitis C Chronic	Associate	20186066, 26070204
HIV Infections	Associate	22114700
Inflammation	Associate	30813269, 36245285
Keratoconus	Associate	31467338
Liver Cirrhosis	Associate	20186066, 26070204, 31721770, 34786828
Liver Cirrhosis Biliary	Associate	14558084
Lung Neoplasms	Associate	12404290
Lupus Erythematosus Systemic	Associate	21436623, 31681284, 33354779
Lupus Erythematosus Systemic	Stimulate	36245285
Lupus Nephritis	Stimulate	33354779, 36245285
Melanoma	Associate	21660451
Metabolic Syndrome	Stimulate	33910911
Moyamoya Disease	Associate	37400835
Myositis	Associate	36661295
Necrosis	Stimulate	30530049
Neoplasm Metastasis	Associate	11815981, 19017490
Neoplasms	Associate	11815981, 12404290, 18450743, 19017490, 23181716, 28627758, 29207493, 31136099
Neoplasms	Stimulate	33955587
Neuroblastoma	Associate	18450743, 21660451
Non alcoholic Fatty Liver Disease	Associate	34786828
Obesity	Associate	33910911
Pain	Associate	35033099
Pancreatic Neoplasms	Associate	11815981, 24471499, 28627758
Plaque Atherosclerotic	Associate	30530049
Pre Eclampsia	Associate	22570525
Prostatic Neoplasms	Associate	37186007
Respiratory Distress Syndrome	Stimulate	34984927
Schizophrenia	Associate	36982982
Small Cell Lung Carcinoma	Associate	28448532
Venous Thrombosis	Associate	20156641
Virus Diseases	Associate	21515679, 36635400

LGALS3BP (galectin 3 binding protein)