LGALS3 (galectin 3)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3958
Gene name Gene Name - the full gene name approved by the HGNC.
Galectin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LGALS3
Synonyms (NCBI Gene) Gene synonyms aliases
CBP35, GAL3, GALBP, GALIG, L31, LGALS2, MAC2
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
miRTarBase ID miRNA Experiments Reference
MIRT003969 hsa-miR-424-3p Northern blot, qRT-PCR, Western blot 17889671
MIRT037600 hsa-miR-744-5p CLASH 23622248
MIRT755578 hsa-miR-128-3p Luciferase reporter assay, qRT-PCR, Western blot 28146425
MIRT755578 hsa-miR-128-3p Western blotting, qRT-PCR 34811696
MIRT1108215 hsa-miR-1208 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
JUN Activation 16285957
RUNX1 Activation 19020999
RUNX2 Activation 19020999
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(63)
GO ID Ontology Definition Evidence Reference
GO:0001772 Component Immunological synapse IBA 21873635
GO:0001772 Component Immunological synapse IDA 19706535
GO:0002548 Process Monocyte chemotaxis IBA 21873635
GO:0002548 Process Monocyte chemotaxis IDA 10925302
GO:0003723 Function RNA binding HDA 22658674
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
153619 6563 ENSG00000131981
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P17931
Protein name Galectin-3 (Gal-3) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Galactose-specific lectin 3) (Galactoside-binding protein) (GALBP) (IgE-binding protein) (L-31) (Laminin-binding protein) (Lectin L-29) (Mac-2 antigen)
Protein function Galactose-specific lectin which binds IgE. May mediate with the alpha-3, beta-1 integrin the stimulation by CSPG4 of endothelial cells migration. Together with DMBT1, required for terminal differentiation of columnar epithelial cells during earl
PDB 1A3K , 1KJL , 1KJR , 2NMN , 2NMO , 2NN8 , 2XG3 , 3AYA , 3AYC , 3AYD , 3AYE , 3T1L , 3T1M , 3ZSJ , 3ZSK , 3ZSL , 3ZSM , 4BLI , 4BLJ , 4BM8 , 4JC1 , 4JCK , 4LBJ , 4LBK , 4LBL , 4LBM , 4LBN , 4LBO , 4R9A , 4R9B , 4R9C , 4R9D , 4RL7 , 4XBN , 5E88 , 5E89 , 5E8A , 5EXO , 5H9P , 5H9R , 5IUQ , 5NF7 , 5NF9 , 5NFA , 5NFB , 5NFC , 5OAX , 5ODY , 6B8K , 6EOG , 6EOL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00337 Gal-bind_lectin 117 → 247 Galactoside-binding lectin Domain
Tissue specificity TISSUE SPECIFICITY: A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes. {ECO:0000269|PubMed:19497882}.
Sequence 
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP
GAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI
DLTSASYTMI
Sequence length 250
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Neutrophil degranulation
RUNX1 regulates transcription of genes involved in differentiation of myeloid cells
RUNX2 regulates genes involved in differentiation of myeloid cells
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Esophagus neoplasm Esophageal Neoplasms, Malignant neoplasm of esophagus rs28934578, rs121918714, rs1567556006, rs1575166666 17634542
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)		 21750908
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)		 23994248
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Cirrhosis Cirrhosis 27870162 ClinVar
Myocardial infarction Myocardial Infarction 29769800 ClinVar
Neuroblastoma Neuroblastoma Loss of SNAI2 function reduces self-renewal, 3D invasion as well as metastatic spread in vivo, while strongly sensitizing neuroblastoma cells to RA-induced growth inhibition. GWAS, CBGDA
Show/Hide Text Mining Associations (310)
Associations from Text Mining
Disease Name Relationship Type References
3C syndrome Associate 32573962
AA amyloidosis Associate 30662332
Abdominal Injuries Associate 26722123
ACTH Secreting Pituitary Adenoma Associate 17724007
Acute Coronary Syndrome Associate 22230397
Adenocarcinoma Associate 15832191, 26625826
Adenocarcinoma Inhibit 24040451
Adenocarcinoma Follicular Associate 17728499, 18415710, 34219881, 34711014
Adenocarcinoma Mucinous Associate 26894286
Adenocarcinoma of Lung Associate 26625826, 29788922, 37265698, 37567864