LGALS1 (galectin 1)

Gene

• Entrez ID: 3956
• Gene name: Galectin 1
• Gene symbol: LGALS1
• Synonyms (NCBI Gene): GAL1, GBP
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023570	hsa-miR-1-3p	Proteomics	18668040
MIRT437402	hsa-miR-22-3p	Immunofluorescence, qRT-PCR, Western blot	24496460

Transcription factors

Transcription factor	Regulation	Reference
PTTG1	Activation	19351864

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002317	Process	Plasma cell differentiation	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	10369126, 23131994, 24529377, 24945728, 28514442, 30021884, 32814053, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	28992109
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	1713454
GO:0007165	Process	Signal transduction	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030395	Function	Lactose binding	IBA
GO:0031012	Component	Extracellular matrix	HDA	20551380, 28327460
GO:0031012	Component	Extracellular matrix	HDA	23979707, 25037231, 27559042, 28675934
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0031295	Process	T cell costimulation	IEA
GO:0042981	Process	Regulation of apoptotic process	TAS	16130169
GO:0043065	Process	Positive regulation of apoptotic process	IDA	12730878
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0043236	Function	Laminin binding	IBA
GO:0045445	Process	Myoblast differentiation	IEA
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	21670307
GO:0048018	Function	Receptor ligand activity	IDA	24752896
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12730878
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098609	Process	Cell-cell adhesion	IDA	18796645
GO:1990724	Component	Galectin complex	IPI	15476813
GO:2000329	Process	Negative regulation of T-helper 17 cell lineage commitment	IDA	20696842, 24752896
GO:2000329	Process	Negative regulation of T-helper 17 cell lineage commitment	IDA	24752896
GO:2001200	Process	Positive regulation of dendritic cell differentiation	IDA	16116184

Other IDs

• MIM: 150570
• HGNC: 6561
• e!Ensembl: ENSG00000100097

Protein

• UniProt ID: P09382
• Protein name: Galectin-1 (Gal-1) (14 kDa laminin-binding protein) (HLBP14) (14 kDa lectin) (Beta-galactoside-binding lectin L-14-I) (Galaptin) (HBL) (HPL) (Lactose-binding lectin 1) (Lectin galactoside-binding soluble 1) (Putative MAPK-activating protein PM12) (S-Lac l
• Protein function: Lectin that binds beta-galactoside and a wide array of complex carbohydrates. Plays a role in regulating apoptosis, cell proliferation and cell differentiation. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Ly
• PDB: 1GZW, 1W6M, 1W6N, 1W6O, 1W6P, 1W6Q, 2KM2, 2ZKN, 3OY8, 3OYW, 3T2T, 3W58, 3W59, 4Q1P, 4Q1R, 4Q26, 4Q27, 4Q2F, 4XBL, 4Y1U, 4Y1V, 4Y1X, 4Y1Y, 4Y1Z, 4Y20, 4Y22, 4Y24, 5MWT, 5MWX, 6B94, 6F83, 6M5Y, 7LTA, 7NML, 8B0W, 8B0Z, 8OJP, 8R74, 8RDC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00337	Gal-bind_lectin	5 → 134	Galactoside-binding lectin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in placenta, maternal decidua and fetal membranes. Within placenta, expressed in trophoblasts, stromal cells, villous endothelium, syncytiotrophoblast apical membrane and villous stroma. Within fetal membranes, expressed in a
• Sequence:

  MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
  CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
  MAADGDFKIKCVAFD

• Sequence length: 135

Pathways

Reactome:

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation