Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3956
Gene name Gene Name - the full gene name approved by the HGNC.	Galectin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LGALS1
Synonyms (NCBI Gene) Gene synonyms aliases	GAL1, GBP
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.1
Summary Summary of gene provided in NCBI Entrez Gene.	The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023570	hsa-miR-1-3p	Proteomics	18668040
MIRT437402	hsa-miR-22-3p	Immunofluorescence, qRT-PCR, Western blot	24496460

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
PTTG1	Activation	19351864

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002317	Process	Plasma cell differentiation	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	10369126, 23131994, 24529377, 24945728, 28514442, 30021884, 32814053, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	20551380
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	28992109
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	1713454
GO:0007165	Process	Signal transduction	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030395	Function	Lactose binding	IBA
GO:0031012	Component	Extracellular matrix	HDA	20551380, 28327460
GO:0031012	Component	Extracellular matrix	HDA	23979707, 25037231, 27559042, 28675934
GO:0031012	Component	Extracellular matrix	ISS	22261194
GO:0031295	Process	T cell costimulation	IEA
GO:0042981	Process	Regulation of apoptotic process	TAS	16130169
GO:0043065	Process	Positive regulation of apoptotic process	IDA	12730878
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0043236	Function	Laminin binding	IBA
GO:0045445	Process	Myoblast differentiation	IEA
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	21670307
GO:0048018	Function	Receptor ligand activity	IDA	24752896
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12730878
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098609	Process	Cell-cell adhesion	IDA	18796645
GO:1990724	Component	Galectin complex	IPI	15476813
GO:2000329	Process	Negative regulation of T-helper 17 cell lineage commitment	IDA	20696842, 24752896
GO:2000329	Process	Negative regulation of T-helper 17 cell lineage commitment	IDA	24752896
GO:2001200	Process	Positive regulation of dendritic cell differentiation	IDA	16116184

MIM	HGNC	e!Ensembl
150570	6561	ENSG00000100097

Protein

UniProt ID

P09382

Protein name

Galectin-1 (Gal-1) (14 kDa laminin-binding protein) (HLBP14) (14 kDa lectin) (Beta-galactoside-binding lectin L-14-I) (Galaptin) (HBL) (HPL) (Lactose-binding lectin 1) (Lectin galactoside-binding soluble 1) (Putative MAPK-activating protein PM12) (S-Lac l

Protein function

Lectin that binds beta-galactoside and a wide array of complex carbohydrates. Plays a role in regulating apoptosis, cell proliferation and cell differentiation. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Ly

PDB

1GZW , 1W6M , 1W6N , 1W6O , 1W6P , 1W6Q , 2KM2 , 2ZKN , 3OY8 , 3OYW , 3T2T , 3W58 , 3W59 , 4Q1P , 4Q1R , 4Q26 , 4Q27 , 4Q2F , 4XBL , 4Y1U , 4Y1V , 4Y1X , 4Y1Y , 4Y1Z , 4Y20 , 4Y22 , 4Y24 , 5MWT , 5MWX , 6B94 , 6F83 , 6M5Y , 7LTA , 7NML , 8B0W , 8B0Z , 8OJP , 8R74 , 8RDC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00337	Gal-bind_lectin	5 → 134	Galactoside-binding lectin	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta, maternal decidua and fetal membranes. Within placenta, expressed in trophoblasts, stromal cells, villous endothelium, syncytiotrophoblast apical membrane and villous stroma. Within fetal membranes, expressed in a

Sequence

MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD

Sequence length

135

Interactions

View interactions

	Reactome
			Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) Post-translational protein phosphorylation

LGALS1 (galectin 1)