Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3953
Gene name	Leptin receptor
Gene symbol	LEPR
Synonyms (NCBI Gene)	CD295LEP-RLEPRDOB-ROBR
Chromosome	1
Chromosome location	1p31.3
Summary	The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulate

Show/Hide all (9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs144159890	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs193922650	C>G,T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant, synonymous variant
rs765551290	A>T	Pathogenic	Stop gained, coding sequence variant
rs945135468	G>A	Pathogenic-likely-pathogenic	Coding sequence variant, stop gained
rs1446132233	C>A,G	Likely-pathogenic	Coding sequence variant, missense variant
rs1474810899	G>A,T	Pathogenic	Splice donor variant
rs1553174844	->AG	Pathogenic	Genic downstream transcript variant, frameshift variant, coding sequence variant
rs1557670950	A>C	Pathogenic	Coding sequence variant, missense variant
rs1557670990	A>-	Pathogenic	Coding sequence variant, frameshift variant

120

Show/Hide all (120)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017009	hsa-miR-335-5p	Microarray	18185580
MIRT037290	hsa-miR-877-5p	CLASH	23622248
MIRT1107495	hsa-miR-1245	CLIP-seq
MIRT1107496	hsa-miR-129-5p	CLIP-seq
MIRT1107497	hsa-miR-142-3p	CLIP-seq
MIRT1107498	hsa-miR-1914	CLIP-seq
MIRT1107499	hsa-miR-204	CLIP-seq
MIRT1107500	hsa-miR-211	CLIP-seq
MIRT1107501	hsa-miR-3137	CLIP-seq
MIRT1107502	hsa-miR-3940-5p	CLIP-seq
MIRT1107503	hsa-miR-4265	CLIP-seq
MIRT1107504	hsa-miR-4287	CLIP-seq
MIRT1107505	hsa-miR-4296	CLIP-seq
MIRT1107506	hsa-miR-4322	CLIP-seq
MIRT1107507	hsa-miR-433	CLIP-seq
MIRT1107508	hsa-miR-4417	CLIP-seq
MIRT1107509	hsa-miR-4469	CLIP-seq
MIRT1107510	hsa-miR-4507	CLIP-seq
MIRT1107511	hsa-miR-450b-5p	CLIP-seq
MIRT1107512	hsa-miR-4685-3p	CLIP-seq
MIRT1107513	hsa-miR-4760-5p	CLIP-seq
MIRT1107514	hsa-miR-507	CLIP-seq
MIRT1107515	hsa-miR-557	CLIP-seq
MIRT1107516	hsa-miR-3671	CLIP-seq
MIRT1107517	hsa-miR-3674	CLIP-seq
MIRT1107518	hsa-miR-3941	CLIP-seq
MIRT1107519	hsa-miR-425	CLIP-seq
MIRT1107520	hsa-miR-4643	CLIP-seq
MIRT1107521	hsa-miR-4659a-3p	CLIP-seq
MIRT1107522	hsa-miR-4659b-3p	CLIP-seq
MIRT1107523	hsa-miR-466	CLIP-seq
MIRT1107524	hsa-miR-4672	CLIP-seq
MIRT1107525	hsa-miR-4680-3p	CLIP-seq
MIRT1107526	hsa-miR-4732-5p	CLIP-seq
MIRT1107513	hsa-miR-4760-5p	CLIP-seq
MIRT1107527	hsa-miR-4789-3p	CLIP-seq
MIRT1107528	hsa-miR-4789-5p	CLIP-seq
MIRT1107529	hsa-miR-607	CLIP-seq
MIRT1550704	hsa-miR-105	CLIP-seq
MIRT1550705	hsa-miR-1182	CLIP-seq
MIRT1550706	hsa-miR-200b	CLIP-seq
MIRT1550707	hsa-miR-200c	CLIP-seq
MIRT1550708	hsa-miR-205	CLIP-seq
MIRT1550709	hsa-miR-3120-5p	CLIP-seq
MIRT1550710	hsa-miR-3154	CLIP-seq
MIRT1550711	hsa-miR-3661	CLIP-seq
MIRT1550712	hsa-miR-3668	CLIP-seq
MIRT1107516	hsa-miR-3671	CLIP-seq
MIRT1107517	hsa-miR-3674	CLIP-seq
MIRT1550713	hsa-miR-4274	CLIP-seq
MIRT1550714	hsa-miR-429	CLIP-seq
MIRT1550715	hsa-miR-451b	CLIP-seq
MIRT1107526	hsa-miR-4732-5p	CLIP-seq
MIRT1550716	hsa-miR-4766-5p	CLIP-seq
MIRT1550717	hsa-miR-4793-5p	CLIP-seq
MIRT1550718	hsa-miR-548a-3p	CLIP-seq
MIRT1550719	hsa-miR-548e	CLIP-seq
MIRT1550720	hsa-miR-548f	CLIP-seq
MIRT1107529	hsa-miR-607	CLIP-seq
MIRT1550721	hsa-miR-622	CLIP-seq
MIRT1550722	hsa-miR-631	CLIP-seq
MIRT1920585	hsa-miR-374a	CLIP-seq
MIRT1920586	hsa-miR-374b	CLIP-seq
MIRT1920587	hsa-miR-4289	CLIP-seq
MIRT1920585	hsa-miR-374a	CLIP-seq
MIRT1920586	hsa-miR-374b	CLIP-seq
MIRT1920587	hsa-miR-4289	CLIP-seq
MIRT2029691	hsa-miR-3160-5p	CLIP-seq
MIRT2029692	hsa-miR-371-5p	CLIP-seq
MIRT2029693	hsa-miR-371b-5p	CLIP-seq
MIRT2029694	hsa-miR-513c	CLIP-seq
MIRT2029695	hsa-miR-514b-5p	CLIP-seq
MIRT1550706	hsa-miR-200b	CLIP-seq
MIRT1550707	hsa-miR-200c	CLIP-seq
MIRT2260575	hsa-miR-30a	CLIP-seq
MIRT2260576	hsa-miR-30b	CLIP-seq
MIRT2260577	hsa-miR-30c	CLIP-seq
MIRT2260578	hsa-miR-30d	CLIP-seq
MIRT2260579	hsa-miR-30e	CLIP-seq
MIRT2260580	hsa-miR-34b	CLIP-seq
MIRT2260581	hsa-miR-3654	CLIP-seq
MIRT2260582	hsa-miR-377	CLIP-seq
MIRT2260583	hsa-miR-378	CLIP-seq
MIRT2260584	hsa-miR-378b	CLIP-seq
MIRT2260585	hsa-miR-378c	CLIP-seq
MIRT2260586	hsa-miR-378d	CLIP-seq
MIRT2260587	hsa-miR-378e	CLIP-seq
MIRT2260588	hsa-miR-378f	CLIP-seq
MIRT2260589	hsa-miR-378h	CLIP-seq
MIRT2260590	hsa-miR-378i	CLIP-seq
MIRT2260591	hsa-miR-422a	CLIP-seq
MIRT1550714	hsa-miR-429	CLIP-seq
MIRT2260592	hsa-miR-4495	CLIP-seq
MIRT2260593	hsa-miR-4641	CLIP-seq
MIRT2260594	hsa-miR-4666-3p	CLIP-seq
MIRT2260595	hsa-miR-4760-3p	CLIP-seq
MIRT2260596	hsa-miR-485-3p	CLIP-seq
MIRT2260597	hsa-miR-586	CLIP-seq
MIRT2560596	hsa-miR-1305	CLIP-seq
MIRT2560597	hsa-miR-191	CLIP-seq
MIRT1550710	hsa-miR-3154	CLIP-seq
MIRT2560598	hsa-miR-34c-3p	CLIP-seq
MIRT1107517	hsa-miR-3674	CLIP-seq
MIRT2560599	hsa-miR-4670-3p	CLIP-seq
MIRT1107526	hsa-miR-4732-5p	CLIP-seq
MIRT2560600	hsa-miR-498	CLIP-seq
MIRT1550718	hsa-miR-548a-3p	CLIP-seq
MIRT1550719	hsa-miR-548e	CLIP-seq
MIRT1550720	hsa-miR-548f	CLIP-seq
MIRT2560601	hsa-miR-570	CLIP-seq
MIRT2560602	hsa-miR-642b	CLIP-seq
MIRT2560596	hsa-miR-1305	CLIP-seq
MIRT2560597	hsa-miR-191	CLIP-seq
MIRT2560598	hsa-miR-34c-3p	CLIP-seq
MIRT2560599	hsa-miR-4670-3p	CLIP-seq
MIRT2560600	hsa-miR-498	CLIP-seq
MIRT1550718	hsa-miR-548a-3p	CLIP-seq
MIRT1550719	hsa-miR-548e	CLIP-seq
MIRT1550720	hsa-miR-548f	CLIP-seq
MIRT2560601	hsa-miR-570	CLIP-seq

Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IMP	21771332
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9537324
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	11279102, 16482222, 17474147, 18042720, 19910644, 20347812, 22405007, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005977	Process	Glycogen metabolic process	IEA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006112	Process	Energy reserve metabolic process	TAS	9537324
GO:0006909	Process	Phagocytosis	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9537324
GO:0007275	Process	Multicellular organism development	TAS	9537324
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0010507	Process	Negative regulation of autophagy	IDA	25060689
GO:0014009	Process	Glial cell proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0017046	Function	Peptide hormone binding	IPI	27037668
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019953	Process	Sexual reproduction	IEA
GO:0019953	Process	Sexual reproduction	ISS
GO:0019955	Function	Cytokine binding	IBA
GO:0030217	Process	T cell differentiation	IEA
GO:0030217	Process	T cell differentiation	ISS
GO:0033210	Process	Leptin-mediated signaling pathway	IDA	27037668
GO:0033210	Process	Leptin-mediated signaling pathway	IEA
GO:0033210	Process	Leptin-mediated signaling pathway	ISS
GO:0038021	Function	Leptin receptor activity	IDA	20977476, 27037668
GO:0038021	Function	Leptin receptor activity	IEA
GO:0038021	Function	Leptin receptor activity	ISS
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042802	Function	Identical protein binding	IPI	20347812
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0044321	Process	Response to leptin	IEA
GO:0044321	Process	Response to leptin	ISS
GO:0045721	Process	Negative regulation of gluconeogenesis	IEA
GO:0046850	Process	Regulation of bone remodeling	IEA
GO:0046850	Process	Regulation of bone remodeling	ISS
GO:0048731	Process	System development	IEA
GO:0051049	Process	Regulation of transport	IDA	20977476
GO:0060259	Process	Regulation of feeding behavior	IEA
GO:0060259	Process	Regulation of feeding behavior	ISS
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IDA	27037668
GO:0098868	Process	Bone growth	IEA
GO:0098868	Process	Bone growth	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	11003997
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653

MIM	HGNC	e!Ensembl
601007	6554	ENSG00000116678

P48357

Protein name

Leptin receptor (LEP-R) (HuB219) (OB receptor) (OB-R) (CD antigen CD295)

Protein function

Receptor for hormone LEP/leptin (Probable) (PubMed:22405007). On ligand binding, mediates LEP central and peripheral effects through the activation of different signaling pathways such as JAK2/STAT3 and MAPK cascade/FOS. In the hypothalamus, LEP

PDB

3V6O , 6E2P , 7Z3Q , 8AVE , 8AVF , 8AVO , 8X80 , 8X81 , 8X85

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18589	ObR_Ig	126 → 233	Obesity receptor immunoglobulin like domain	Domain
PF06328	Lep_receptor_Ig	329 → 420	Ig-like C2-type domain	Domain
PF18589	ObR_Ig	431 → 533	Obesity receptor immunoglobulin like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform A is expressed in fetal liver and in hematopoietic tissues and choroid plexus. In adults highest expression in heart, liver, small intestine, prostate and ovary. Low level in lung and kidney. Isoform B is highly expressed in hy

Sequence

MICQKFCVVLLHWEFIYVITAFNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNS
NGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVF
QQIDANWNIQCWLKGDLKLFICYVESLFKNLFRNYNYKVHLLYVLPEVLEDSPLVPQKGS
FQMVHCNCSVHECCECLVPVPTAKLNDTLLMCLKITSGGVIFQSPLMSVQPINMVKPDPP
LGLHMEITDDGNLKISWSSPPLVPFPLQYQVKYSENSTTVIREADKIVSATSLLVDSILP
GSSYEVQVRGKRLDGPGIWSDWSTPRVFTTQDVIYFPPKILTSVGSNVSFHCIYKKENKI
VPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIH
PISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPP
SSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPV
PDLCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNV
TLLWKPLMKNDSLCSVQRYVINHHTSCNGTWSEDVGNHTKFTFLWTEQAHTVTVLAINSI
GASVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVIVSWILSPSDYKLMYFIIEWKNLNED
GEIKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSDA
GLYVIVPVIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFI
KHTASVTCGPLLLEPETISEDISVDTSWKNKDEMMPTTVVSLLSTTDLEKGSVCISDQFN
SVNFSEAEGTEVTYEDESQRQPFVKYATLISNSKPSETGEEQGLINSSVTKCFSSKNSPL
KDSFSNSSWEIEAQAFFILSDQHPNIISPHLTFSEGLDELLKLEGNFPEENNDKKSIYYL
GVTSIKKRESGVLLTDKSRVSCPFPAPCLFTDIRVLQDSCSHFVENNINLGTSSKKTFAS
YMPQFQTCSTQTHKIMENKMCDLTV

Sequence length

1165

Interactions

View interactions

	KEGG
	Cytokine-cytokine receptor interaction Neuroactive ligand-receptor interaction Hormone signaling AMPK signaling pathway JAK-STAT signaling pathway Adipocytokine signaling pathway Non-alcoholic fatty liver disease

294

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Early onset severe obesity	Likely pathogenic	rs2100932956	RCV006280922
LEPR-related disorder	Likely pathogenic; Pathogenic	rs1469336975, rs945135468, rs1557670990, rs144159890	RCV004531970 RCV004735562 RCV004735783 RCV000778251
Obesity	Likely pathogenic	rs193922650	RCV000030138
Obesity due to congenital leptin deficiency	Likely pathogenic	rs866641122	RCV004577246
Obesity due to leptin receptor gene deficiency	Likely pathogenic; Pathogenic	rs757358893, rs1474810899, rs1553174844, rs1557670950, rs144159890	RCV002226617 RCV000009048 RCV000626385 RCV000760143 RCV002250694

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs4655566, rs70940803	RCV005916649 RCV005920242
Cervical cancer	Benign	rs4655566	RCV005916650
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	rs70940803	RCV005920247
Clear cell carcinoma of kidney	Uncertain significance	rs369475236	RCV005927104
Gastric cancer	Benign	rs70940803	RCV005920244
LEPR POLYMORPHISM	Benign; Likely benign	rs1137101, rs1137100, rs1805094	RCV006252368 RCV006252369 RCV006252370
Lung cancer	Benign	rs4655566	RCV005916652
Lymphoma	Benign	rs70940803	RCV005920245
Malignant lymphoma, large B-cell, diffuse	Benign	rs70940803	RCV005920243
Monogenic diabetes	Conflicting classifications of pathogenicity; Uncertain significance; Benign; Likely benign	rs145685060, rs35573508, rs142647085, rs145651189, rs147667928, rs1057524881, rs34499590, rs1805094, rs751025808, rs149329546, rs148349369, rs937591370, rs142143966	RCV000445411 RCV001174405 RCV000445533 RCV000664073 RCV000445543 RCV000445404 RCV000445476 RCV000445542 RCV000664072 RCV000664074 RCV001174406 RCV001174407 RCV001174408
Monogenic Non-Syndromic Obesity	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	rs1137101, rs1137100, rs1805094, rs372078226, rs189950527, rs116571599, rs531183918, rs144710810, rs755504289, rs34130975, rs145685060, rs886046506, rs35573508, rs151190195, rs780534740 View all (17 more)	RCV000281795 RCV000366432 RCV000266874 RCV000280221 RCV000311543 RCV000363116 RCV000395676 RCV000355839 RCV000357850 RCV000304846 RCV000325519 RCV000331897 RCV000264920 RCV000259292 RCV000301046 RCV000333192 RCV000405881 RCV000359598 RCV000318844 RCV000342499 RCV000283917 RCV000396999 RCV000373738 RCV000288988 RCV000335664 RCV000373522 RCV000386595 RCV000297351 RCV000327637 RCV000387680 RCV000276727 RCV000365066
Peripheral precocious puberty	Uncertain significance	rs2101046855	RCV001374431
Premature ovarian failure	Uncertain significance	rs1656071790	RCV001270185
Sarcoma	Benign; Conflicting classifications of pathogenicity	rs4655566, rs35573508	RCV005916651 RCV005891736
Thymoma	Benign	rs70940803	RCV005920246
Uterine corpus endometrial carcinoma	Benign; Conflicting classifications of pathogenicity	rs4655566, rs35573508	RCV005916653 RCV005891737

Show/Hide Text Mining Associations (175)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Habitual	Associate	38275620
Abortion Spontaneous	Associate	34407095
Acute Coronary Syndrome	Associate	19023160
Adenocarcinoma of Lung	Associate	23111975
Adenoma	Associate	21166956
Adrenal Gland Diseases	Associate	39201370
Adrenal Gland Neoplasms	Associate	39201370
Albuminuria	Associate	15189365
Alzheimer Disease	Associate	23895348
Amebiasis	Associate	21393862
Anorexia Nervosa	Associate	16847749
Asthma	Associate	19539983, 30231898, 31029506
Astrocytoma	Associate	19775291, 26894859
Atherosclerosis	Associate	10731922, 18829234
Bipolar Disorder	Associate	36077028
Brain Neoplasms	Associate	19775291, 21771332
Breast Neoplasms	Associate	16504019, 16533767, 17344214, 18945363, 19017403, 20569445, 21516303, 24716804, 25482303, 25846733, 26395295, 26472474, 26556856, 26865587, 28190851 View all (11 more)
Carcinogenesis	Associate	16565226, 23593308, 33864589
Carcinoma Hepatocellular	Associate	15300888, 16565226, 18473418, 33369452
Carcinoma Renal Cell	Associate	24935373, 28543182, 32802842, 36052737
Carcinoma Squamous Cell	Associate	32825970, 33671013
Cardiovascular Diseases	Associate	25923461, 27310420, 28771179, 30983550
Carotid Stenosis	Associate	18829234
Clear cell metastatic renal cell carcinoma	Associate	27480179
Cognition Disorders	Associate	30111348
Colitis Ulcerative	Associate	33159578
Colonic Neoplasms	Associate	31983119
Colorectal Neoplasms	Associate	17591803, 18059035, 23558862, 23593308, 25778303, 31021558, 31983119, 35115495, 36981858, 37282602
Combined Pituitary Hormone Deficiency	Associate	37728464
Compassion Fatigue	Associate	21943151
Coronary Artery Disease	Associate	26191329, 32049202
Coronary Disease	Associate	19567438
Craniopharyngioma	Associate	37509115
Cytokine Release Syndrome	Associate	14632752
Death	Associate	21943151
Diabetes Gestational	Associate	26303856, 27034205, 28699988
Diabetes Mellitus	Associate	10947884, 12270921, 15189365, 20167575, 20624279, 27322064, 30442103, 31046466, 36218419, 37776770, 38127688
Diabetes Mellitus Type 1	Associate	24304572, 36218419
Diabetes Mellitus Type 2	Associate	10947884, 15189365, 15833934, 15919835, 20624279, 22215535, 24414038, 24549597, 27246810, 27322064, 28699988, 28758947, 29301582, 35052401, 37582184
Diffuse Neurofibrillary Tangles with Calcification	Associate	23895348
Disease Resistance	Associate	36512575
Down Syndrome	Associate	28627638
Drug Hypersensitivity	Inhibit	30951821
Dwarfism Pituitary	Associate	26915772, 27649665, 33762520
Dyslipidemias	Associate	26365669, 36157437
Endocrine System Diseases	Associate	27246810, 37728464
Endometrial Neoplasms	Associate	25171477, 25811593, 34399708
Endometriosis	Associate	24401660
Epilepsy	Associate	22647716
Essential Hypertension	Associate	24171506, 24522342
Fatty Liver	Associate	19401628, 23278404
Fatty Liver Alcoholic	Associate	23278404, 33369452
Feeding and Eating Disorders	Associate	28096764, 36241774
Fetal Diseases	Associate	24304572
Fetal Growth Retardation	Associate	26303856, 27330572
Fibrosis	Associate	23278404, 36142381
Food Addiction	Associate	23670889
Fractures Bone	Associate	17243864
Gestational Trophoblastic Disease	Associate	23089140
Gestational Weight Gain	Associate	31794592
Glioblastoma	Associate	19775291, 21771332, 24131927
Graves Ophthalmopathy	Associate	33988300
Heart Failure	Associate	12559213
HELLP Syndrome	Associate	20149225
Hematuria Benign Familial	Stimulate	17006991
Hepatitis Viral Human	Associate	17060687
HIV Infections	Stimulate	12100031
Hypercholesterolemia	Associate	26365669
Hyperglycemia	Associate	36602128
Hyperlipidemias	Associate	26984935
Hyperphagia	Associate	26925581, 30442103, 35123544, 35192151, 35809703, 37728464
Hypertension	Associate	15189365, 16785148, 19562039, 24414038, 24485307, 36157437
Hypertension Pregnancy Induced	Associate	22713493
Hypertriglyceridemia	Associate	26365669
Hypertrophy Left Ventricular	Associate	24485307
Hypogonadism	Associate	26925581
Hypoxia	Stimulate	16533767, 17591803
Hypoxia	Associate	20569445
Infections	Associate	21393862, 21943151
Infertility	Associate	34407095, 37662867
Infertility Male	Associate	27813378, 37662867
Inflammation	Associate	26558825, 28771179, 30945673, 31029506, 36142381
Inflammatory Bowel Diseases	Associate	33159578
Insulin Resistance	Associate	19401628, 20032477, 20167575, 24414038, 28771179, 33245096, 36128550
Intellectual Disability	Associate	22647716
Intestinal Diseases	Associate	16437696, 21393862
Intestinal Diseases	Inhibit	26242176
Kidney Neoplasms	Stimulate	33299884
Leiomyoma	Associate	35598777
Leukemia Lymphocytic Chronic B Cell	Associate	9722301
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	29284680
Leukemia Myeloid	Associate	10029596
Leukemia Myeloid Acute	Associate	10029596, 9722301
Leukemia Promyelocytic Acute	Associate	10029596, 14630813
Liver Abscess Amebic	Associate	21393862
Liver Diseases	Associate	23278404
Lung Neoplasms	Associate	25027400
Lupus Erythematosus Systemic	Associate	28244652
Lymphatic Metastasis	Stimulate	17006991, 25171477
Lymphatic Metastasis	Associate	25482303, 26147886, 26634459, 31983119
Lymphoma B Cell	Associate	22666399
Lymphoma Non Hodgkin	Associate	16160698, 23840460, 26147886
MASS syndrome	Associate	26064921
Melanoma	Associate	18836419
Meningioma	Associate	21948653, 26894859
Meningomyelocele	Associate	23427181
Mental Disorders	Associate	26303856
Metabolic Diseases	Associate	18282109, 24498038, 34407095, 37728464
Metabolic Syndrome	Associate	18439548, 20032477, 22734460, 27310420, 27681143, 35216509, 36117520, 36602128, 38127688
Miller McKusick Malvaux Syndrome (3M Syndrome)	Associate	30111348
Myelodysplastic Syndromes	Associate	10029596
Myocardial Infarction	Associate	24549597
Myotonic Dystrophy	Associate	24549597
Neoplasm Metastasis	Stimulate	17006991, 32836215
Neoplasm Metastasis	Associate	31129149, 31983119, 32573960
Neoplasms	Associate	17006991, 17591803, 18945363, 19775291, 20569445, 23593308, 24935373, 25171477, 26431176, 26634459, 26894859, 28543182, 30803210, 31983119, 32596369, 33019728, 33067778 View all (2 more)
Neoplasms	Inhibit	25351156
Neoplasms	Stimulate	28861689
Neoplasms Adipose Tissue	Associate	11743056, 15919835, 17243864, 21512510, 24319006, 24947733, 26064921, 31948470, 34872092, 35747935, 37676424
Neuroblastoma	Associate	15606754
Non alcoholic Fatty Liver Disease	Associate	22215535, 23278404, 30001365
Obesity	Associate	10947884, 11743056, 12270921, 12646666, 16807515, 17124363, 17229951, 18204169, 18273796, 19265796, 19697123, 19818126, 20624279, 21204206, 21233811 View all (76 more)
Obesity	Stimulate	28713075
Obesity	Inhibit	35111163
Obesity Abdominal	Associate	28428959
Obesity Maternal	Inhibit	30732639
Obesity Metabolically Benign	Associate	34779381
Obesity Morbid	Associate	22734460, 28096764, 28377240, 31852448, 33221380
Oropharyngeal Neoplasms	Associate	26634459
Osteoarthritis	Associate	32245507
Osteoarthritis Knee	Associate	27457563
Osteogenesis imperfecta type 1A	Associate	26395295
Osteoporosis	Associate	17243864, 19023160, 29559840, 35086395
Osteosarcoma	Associate	32787464
Ovarian Diseases	Associate	23579009
Ovarian Neoplasms	Associate	19765303, 28861689, 29976638
Ovarian Neoplasms	Stimulate	31129149
Overweight	Associate	18654948, 21233811, 21233812, 21631924, 22734460, 31948470, 35886710
Overweight	Stimulate	22278432
Pancreatic Neoplasms	Associate	27780823, 37555827
Pediatric Obesity	Associate	30442103
Periapical Granuloma	Associate	25662559
Peripheral Vascular Diseases	Associate	15189365
Peritonitis	Associate	21943151
Personality Disorders	Associate	25351156, 32573960
Polycystic Ovary Syndrome	Associate	29749830, 30635060, 33245096, 34407095
Post Infectious Disorders	Associate	37776770
Pre Eclampsia	Associate	17071538, 20149225, 22713493, 25879409, 38275620
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	9722301
Pregnancy Complications	Associate	38275620
Prehypertension	Associate	17071538
Premature Birth	Associate	38275620
Prenatal Exposure Delayed Effects	Associate	30111348
Primary Myelofibrosis	Associate	37267917
Prostatic Neoplasms	Associate	18958356, 21846818
Prostatic Neoplasms	Stimulate	32573960
Prostatitis	Associate	25351156
Pulmonary Disease Chronic Obstructive	Associate	16135719
Rare Diseases	Associate	26548314
Renal Insufficiency	Stimulate	22265003
Ring Chromosome 20 Syndrome	Associate	22647716
Scoliosis	Associate	37302424
Septate Uterus	Associate	26242176
Sleep Apnea Obstructive	Associate	18204169, 30001365, 31372721, 32711518
Sleep Apnea Syndromes	Associate	23609427
Spinal Dysraphism	Associate	18212354, 21204206
Spondylocostal dysostosis autosomal recessive	Associate	17243864
Squamous Cell Carcinoma of Head and Neck	Associate	25809704, 26634459
Status Asthmaticus	Associate	23383125
Stomach Neoplasms	Associate	16437696, 17006991, 26147886
Triple Negative Breast Neoplasms	Associate	28729467, 32471192
Urinary Bladder Neoplasms	Associate	37892180
Uterine Cervical Neoplasms	Associate	33671013, 36973995
Weight Gain	Associate	12634434, 25740917, 32429577
Weight Loss	Associate	12634434, 19265796, 20383037, 27240401, 27897403, 30126176, 39427540

LEPR (leptin receptor)