Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	395
Gene name	Rho GTPase activating protein 6
Gene symbol	ARHGAP6
Synonyms (NCBI Gene)	RHOGAP6RHOGAPX-1
Chromosome	X
Chromosome location	Xp22.2
Summary	This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of actin polymerization at the plasma membrane during several cellular processes. This protein is thought to have two independent functions, one as a GTPase-ac

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments	Reference
MIRT638978	hsa-miR-369-3p	HITS-CLIP	23824327
MIRT638977	hsa-miR-5692b	HITS-CLIP	23824327
MIRT638976	hsa-miR-5692c	HITS-CLIP	23824327
MIRT638975	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT638974	hsa-miR-374c-5p	HITS-CLIP	23824327
MIRT638973	hsa-miR-655-3p	HITS-CLIP	23824327
MIRT638972	hsa-miR-374a-5p	HITS-CLIP	23824327
MIRT638971	hsa-miR-374b-5p	HITS-CLIP	23824327
MIRT638970	hsa-miR-623	HITS-CLIP	23824327
MIRT638969	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT638968	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT638967	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT638966	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT638965	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT638978	hsa-miR-369-3p	HITS-CLIP	23824327
MIRT638977	hsa-miR-5692b	HITS-CLIP	23824327
MIRT638976	hsa-miR-5692c	HITS-CLIP	23824327
MIRT638975	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT638974	hsa-miR-374c-5p	HITS-CLIP	23824327
MIRT638973	hsa-miR-655-3p	HITS-CLIP	23824327
MIRT638972	hsa-miR-374a-5p	HITS-CLIP	23824327
MIRT638971	hsa-miR-374b-5p	HITS-CLIP	23824327
MIRT638970	hsa-miR-623	HITS-CLIP	23824327
MIRT638969	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT638968	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT638967	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT638966	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT638965	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT756475	hsa-miR-96-5p	Luciferase reporter assayWestern blottingqRT-PCR	34338998
MIRT795014	hsa-miR-1207-3p	CLIP-seq
MIRT795015	hsa-miR-186	CLIP-seq
MIRT795016	hsa-miR-3148	CLIP-seq
MIRT795017	hsa-miR-4646-5p	CLIP-seq
MIRT795018	hsa-miR-4668-5p	CLIP-seq
MIRT795019	hsa-miR-4712-5p	CLIP-seq
MIRT795020	hsa-miR-770-5p	CLIP-seq
MIRT795021	hsa-miR-1257	CLIP-seq
MIRT795022	hsa-miR-3611	CLIP-seq
MIRT795023	hsa-miR-4753-3p	CLIP-seq
MIRT795024	hsa-miR-4768-5p	CLIP-seq
MIRT795025	hsa-miR-758	CLIP-seq
MIRT795017	hsa-miR-4646-5p	CLIP-seq
MIRT2174529	hsa-miR-1238	CLIP-seq
MIRT2174530	hsa-miR-1271	CLIP-seq
MIRT2174531	hsa-miR-182	CLIP-seq
MIRT2174532	hsa-miR-595	CLIP-seq
MIRT2174533	hsa-miR-96	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	10699171
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	NAS	10699171
GO:0007015	Process	Actin filament organization	IBA
GO:0007015	Process	Actin filament organization	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	NAS	10699171
GO:0007266	Process	Rho protein signal transduction	TAS	9417914
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	ISS	10699171
GO:0016004	Function	Phospholipase activator activity	IDA	18434237
GO:0017124	Function	SH3 domain binding	IEA
GO:0030041	Process	Actin filament polymerization	NAS	10699171
GO:0043274	Function	Phospholipase binding	IPI	18434237
GO:0048041	Process	Focal adhesion assembly	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051497	Process	Negative regulation of stress fiber assembly	IMP	10699171
GO:0051895	Process	Negative regulation of focal adhesion assembly	IMP	10699171
GO:0072686	Component	Mitotic spindle	IDA
GO:0141214	Process	Positive regulation of phospholipase C/protein kinase C signal transduction	IDA	18434237
GO:1902533	Process	Positive regulation of intracellular signal transduction	IEA

MIM	HGNC	e!Ensembl
300118	676	ENSG00000047648

O43182

Protein name

Rho GTPase-activating protein 6 (Rho-type GTPase-activating protein 6) (Rho-type GTPase-activating protein RhoGAPX-1)

Protein function

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Could regulate the interactions of signaling molecules with the actin cytoskeleton. Promotes continuous elongation of cytoplasmic processes during cell

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00620	RhoGAP	411 → 572	RhoGAP domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in kidney, heart and skeletal muscle followed by retina, lymphoblast, placenta, lung, brain, pancreas and liver.

Sequence

MSAQSLLHSVFSCSSPASSSAASAKGFSKRKLRQTRSLDPALIGGCGSDEAGAEGSARGA
TAGRLYSPSLPAESLGPRLASSSRGPPPRATRLPPPGPLCSSFSTPSTPQEKSPSGSFHF
DYEVPLGRGGLKKSMAWDLPSVLAGPASSRSASSILCSSGGGPNGIFASPRRWLQQRKFQ
SPPDSRGHPYVVWKSEGDFTWNSMSGRSVRLRSVPIQSLSELERARLQEVAFYQLQQDCD
LSCQITIPKDGQKRKKSLRKKLDSLGKEKNKDKEFIPQAFGMPLSQVIANDRAYKLKQDL
QRDEQKDASDFVASLLPFGNKRQNKELSSSNSSLSSTSETPNESTSPNTPEPAPRARRRG
AMSVDSITDLDDNQSRLLEALQLSLPAEAQSKKEKARDKKLSLNPIYRQVPRLVDSCCQH
LEKHGLQTVGIFRVGSSKKRVRQLREEFDRGIDVSLEEEHSVHDVAALLKEFLRDMPDPL
LTRELYTAFINTLLLEPEEQLGTLQLLIYLLPPCNCDTLHRLLQFLSIVARHADDNISKD
GQEVTGNKMTSLNLATIFGPNLLHKQKSSDKEFSVQSSARAEESTAIIAVVQKMIENYEA
LFMVPPDLQNEVLISLLETDPDVVDYLLRRKASQSSSPDMLQSEVSFSVGGRHSSTDSNK
ASSGDISPYDNNSPVLSERSLLAMQEDAAPGGSEKLYRVPGQFMLVGHLSSSKSRESSPG
PRLGKDLSEEPFDIWGTWHSTLKSGSKDPGMTGSSGDIFESSSLRAGPCSLSQGNLSPNW
PRWQGSPAELDSDTQGARRTQAAAPATEGRAHPAVSRACSTPHVQVAGKAERPTARSEQY
LTLSGAHDLSESELDVAGLQSRATPQCQRPHGSGRDDKRPPPPYPGPGKPAAAAAWIQGP
PEGVETPTDQGGQAAEREQQVTQKKLSSANSLPAGEQDSPRLGDAGWLDWQRERWQIWEL
LSTDNPDALPETLV

Sequence length

974

Interactions

View interactions

	Reactome
			Rho GTPase cycle

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
ARHGAP6-related disorder	Likely benign	rs72558047	RCV003955911
Cholangiocarcinoma	Likely benign	rs1473292516	RCV005910732
Neurodevelopmental disorder	Likely benign	rs769596416	RCV001262663
Sarcoma	Likely benign	rs1473292516	RCV005910731
Thyroid cancer, nonmedullary, 1	Uncertain significance	rs1404266777	RCV005939053
Uterine corpus endometrial carcinoma	Likely benign	rs1473292516	RCV005910733

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Aniridia	Associate	27124303
Aniridia cerebellar ataxia mental deficiency	Associate	27124303
Arthritis Rheumatoid	Associate	30518319
Colorectal Neoplasms	Associate	19960375, 22276153
Nasopharyngeal Carcinoma	Associate	30909962
Uterine Cervical Neoplasms	Associate	28351298

ARHGAP6 (Rho GTPase activating protein 6)