Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3945
Gene name Gene Name - the full gene name approved by the HGNC.	Lactate dehydrogenase B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LDHB
Synonyms (NCBI Gene) Gene synonyms aliases	HEL-S-281, LDH-B, LDH-H, LDHBD, TRG-5
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p12.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have bee

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs118203895	C>T	Affects	Coding sequence variant, missense variant
rs118203896	T>G	Affects	Coding sequence variant, missense variant
rs118203897	T>C	Affects	Coding sequence variant, missense variant
rs267607212	A>G	Affects	Genic downstream transcript variant, missense variant, coding sequence variant

Show/Hide all(75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019875	hsa-miR-375	Microarray	20215506
MIRT050573	hsa-miR-20a-5p	CLASH	23622248
MIRT048552	hsa-miR-100-5p	CLASH	23622248
MIRT048133	hsa-miR-197-3p	CLASH	23622248
MIRT046914	hsa-miR-221-3p	CLASH	23622248
MIRT045350	hsa-miR-185-5p	CLASH	23622248
MIRT043198	hsa-miR-324-5p	CLASH	23622248
MIRT040197	hsa-miR-615-3p	CLASH	23622248
MIRT039024	hsa-miR-766-3p	CLASH	23622248
MIRT038609	hsa-miR-186-3p	CLASH	23622248
MIRT019875	hsa-miR-375	Immunohistochemistry, Luciferase reporter assay, Microarray, QRTPCR	23497265
MIRT019875	hsa-miR-375	Microarray, qRT-PCR, Western blot	22752059
MIRT054322	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	23064179
MIRT054323	hsa-miR-24-3p	Luciferase reporter assay, qRT-PCR	23064179
MIRT054324	hsa-miR-210-3p	Luciferase reporter assay, qRT-PCR	23064179
MIRT2260275	hsa-miR-23a	CLIP-seq
MIRT2260276	hsa-miR-23b	CLIP-seq
MIRT2260277	hsa-miR-23c	CLIP-seq
MIRT2260278	hsa-miR-335	CLIP-seq
MIRT2260279	hsa-miR-34b	CLIP-seq
MIRT2260280	hsa-miR-3670	CLIP-seq
MIRT2260281	hsa-miR-4330	CLIP-seq
MIRT2430709	hsa-miR-4677-3p	CLIP-seq
MIRT2430710	hsa-miR-4679	CLIP-seq
MIRT2430711	hsa-miR-4778-5p	CLIP-seq
MIRT2560432	hsa-miR-1225-3p	CLIP-seq
MIRT2560433	hsa-miR-1233	CLIP-seq
MIRT2560434	hsa-miR-1255a	CLIP-seq
MIRT2560435	hsa-miR-1255b	CLIP-seq
MIRT2560436	hsa-miR-1279	CLIP-seq
MIRT2260275	hsa-miR-23a	CLIP-seq
MIRT2260276	hsa-miR-23b	CLIP-seq
MIRT2260277	hsa-miR-23c	CLIP-seq
MIRT2560437	hsa-miR-3185	CLIP-seq
MIRT2560438	hsa-miR-330-3p	CLIP-seq
MIRT2260278	hsa-miR-335	CLIP-seq
MIRT2560439	hsa-miR-338-5p	CLIP-seq
MIRT2260280	hsa-miR-3670	CLIP-seq
MIRT2260281	hsa-miR-4330	CLIP-seq
MIRT2560440	hsa-miR-4484	CLIP-seq
MIRT2560441	hsa-miR-4509	CLIP-seq
MIRT2430709	hsa-miR-4677-3p	CLIP-seq
MIRT2430710	hsa-miR-4679	CLIP-seq
MIRT2560442	hsa-miR-4709-3p	CLIP-seq
MIRT2560443	hsa-miR-4716-5p	CLIP-seq
MIRT2560444	hsa-miR-4775	CLIP-seq
MIRT2430711	hsa-miR-4778-5p	CLIP-seq
MIRT2560445	hsa-miR-4802-3p	CLIP-seq
MIRT2560446	hsa-miR-490-5p	CLIP-seq
MIRT2560447	hsa-miR-548an	CLIP-seq
MIRT2560448	hsa-miR-548g	CLIP-seq
MIRT2560449	hsa-miR-570	CLIP-seq
MIRT2560450	hsa-miR-590-3p	CLIP-seq
MIRT2560451	hsa-miR-640	CLIP-seq
MIRT2560432	hsa-miR-1225-3p	CLIP-seq
MIRT2560433	hsa-miR-1233	CLIP-seq
MIRT2560436	hsa-miR-1279	CLIP-seq
MIRT2260275	hsa-miR-23a	CLIP-seq
MIRT2260276	hsa-miR-23b	CLIP-seq
MIRT2260277	hsa-miR-23c	CLIP-seq
MIRT2560437	hsa-miR-3185	CLIP-seq
MIRT2560438	hsa-miR-330-3p	CLIP-seq
MIRT2260278	hsa-miR-335	CLIP-seq
MIRT2560439	hsa-miR-338-5p	CLIP-seq
MIRT2260280	hsa-miR-3670	CLIP-seq
MIRT2260281	hsa-miR-4330	CLIP-seq
MIRT2430709	hsa-miR-4677-3p	CLIP-seq
MIRT2430710	hsa-miR-4679	CLIP-seq
MIRT2560442	hsa-miR-4709-3p	CLIP-seq
MIRT2560443	hsa-miR-4716-5p	CLIP-seq
MIRT2560444	hsa-miR-4775	CLIP-seq
MIRT2430711	hsa-miR-4778-5p	CLIP-seq
MIRT2560448	hsa-miR-548g	CLIP-seq
MIRT2560450	hsa-miR-590-3p	CLIP-seq
MIRT2560451	hsa-miR-640	CLIP-seq

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004457	Function	Lactate dehydrogenase activity	IEA
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	IBA
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	IDA	27618187
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	IEA
GO:0004459	Function	L-lactate dehydrogenase (NAD+) activity	TAS	8314553
GO:0005515	Function	Protein binding	IPI	21044950, 21988832, 24725412, 25416956, 25910212, 28514442, 31515488, 32296183, 32814053, 33406399, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	27618187
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006089	Process	Lactate metabolic process	IBA
GO:0006089	Process	Lactate metabolic process	IDA	15117937
GO:0006089	Process	Lactate metabolic process	IEA
GO:0006089	Process	Lactate metabolic process	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA
GO:0019674	Process	NAD+ metabolic process	IEA
GO:0019752	Process	Carboxylic acid metabolic process	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 25502805, 31515488, 32296183
GO:0042867	Process	Pyruvate catabolic process	IBA
GO:0045121	Component	Membrane raft	IDA	25204797
GO:0051287	Function	NAD binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:1990204	Component	Oxidoreductase complex	IPI	15117937
GO:1990204	Component	Oxidoreductase complex	ISS

MIM	HGNC	e!Ensembl
150100	6541	ENSG00000111716

Protein

UniProt ID

P07195

Protein name

L-lactate dehydrogenase B chain (LDH-B) (EC 1.1.1.27) (LDH heart subunit) (LDH-H) (Renal carcinoma antigen NY-REN-46)

Protein function

Interconverts simultaneously and stereospecifically pyruvate and lactate with concomitant interconversion of NADH and NAD(+).

PDB

1I0Z , 1T2F , 7DBJ , 7DBK , 8QDE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00056	Ldh_1_N	22 → 161	lactate/malate dehydrogenase, NAD binding domain	Family
PF02866	Ldh_1_C	164 → 334	lactate/malate dehydrogenase, alpha/beta C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in aerobic tissues such as cardiac muscle. {ECO:0000305|PubMed:11276087}.

Sequence

MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Sequence length

334

Interactions

View interactions

	KEGG		Reactome
	Glycolysis / Gluconeogenesis Cysteine and methionine metabolism Pyruvate metabolism Propanoate metabolism Metabolic pathways HIF-1 signaling pathway Glucagon signaling pathway Central carbon metabolism in cancer		Pyruvate metabolism

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Glycogen Storage Disease	glycogen storage disease due to lactate dehydrogenase h-subunit deficiency, glycogen storage disease due to lactate dehydrogenase H-subunit deficiency	N/A	N/A	ClinVar, GenCC

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acidosis Lactic	Associate	30923124
Adenocarcinoma of Lung	Associate	34335635
Alzheimer Disease	Associate	37545529
Breast Diseases	Associate	34092577
Breast Neoplasms	Associate	21177384, 23437403, 23697991, 25575825, 34092577
Carcinoma Embryonal	Stimulate	33565425
Carcinoma Hepatocellular	Associate	26426634, 30923124, 33237575, 37803338
Carcinoma Non Small Cell Lung	Associate	30453281
Carcinoma Renal Cell	Associate	37547725
Cholangiocarcinoma	Associate	34176927
Colitis Ulcerative	Associate	22726388
Colorectal Neoplasms	Associate	30745849, 31424671, 33994363
Endodermal Sinus Tumor	Associate	33565425
Ependymoma	Associate	14578171
Fibroadenoma	Associate	34092577
Glioblastoma	Associate	33553434
Helicobacter Infections	Stimulate	14711373
Hereditary leiomyomatosis and renal cell cancer	Associate	28505189
Hypoxia	Associate	34176927, 37653539
Idiopathic Noncirrhotic Portal Hypertension	Associate	33237575
Idiopathic Pulmonary Fibrosis	Associate	34711218, 37653539
Lung Neoplasms	Associate	34334381
Lymphatic Metastasis	Associate	26426634
Medulloblastoma	Associate	18593994
Melanoma	Associate	39213172
Meningitis Cryptococcal	Associate	39214781
Mitochondrial Diseases	Stimulate	25575825
Mitochondrial Diseases	Associate	30923124
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Associate	30923124
Muscular Dystrophy Duchenne	Associate	40483507
Myositis	Associate	23697991
Neoplasms	Associate	14578171, 21177384, 23516535, 23697991, 25266796, 26426634, 32484203, 34022218, 34092577, 34176927, 35075123, 35682650, 37547725
Neuroblastoma	Associate	31511046
Ovarian Neoplasms	Associate	39587817
Pleural Effusion Malignant	Associate	36567801
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	32391634
Prostatic Neoplasms	Associate	29891507, 35242214
Squamous Cell Carcinoma of Head and Neck	Associate	25973606
Teratoma	Associate	33565425
Testicular Germ Cell Tumor	Associate	33565425
Thyroid Cancer Papillary	Associate	33792181
Urinary Bladder Neoplasms	Associate	25266796

LDHB (lactate dehydrogenase B)