Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
394263
Gene name Gene Name - the full gene name approved by the HGNC.
Mucin 21, cell surface associated
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MUC21
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf205, KMQK697, MUC-21
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a large membrane-bound glycoprotein which is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in in
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050861 hsa-miR-17-5p CLASH 23622248
MIRT725361 hsa-miR-25-3p HITS-CLIP 19536157
MIRT725360 hsa-miR-32-5p HITS-CLIP 19536157
MIRT725359 hsa-miR-363-3p HITS-CLIP 19536157
MIRT725358 hsa-miR-367-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005796 Component Golgi lumen TAS
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616991 21661 ENSG00000204544
Protein
UniProt ID Q5SSG8
Protein name Mucin-21 (MUC-21) (Epiglycanin)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05647 Epiglycanin_TR 18 83 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 76 137 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 123 182 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 167 227 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 181 239 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 211 274 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 271 334 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 331 393 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 391 458 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF14654 Epiglycanin_C 463 564 Mucin, catalytic, TM and cytoplasmic tail region Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung, large intestine, thymus, and testis. Expressed in normal and malignant bronchial epithelial cells. {ECO:0000269|PubMed:17977904}.
Sequence
MKMQKGNVLLMFGLLLHLEAATNSNETSTSANTGSSVISSGASTATNSGSSVTSSGVSTA
TISGSSVTSNGVSIV
TNSEFHTTSSGISTATNSEFSTVSSGISIATNSESSTTSSGASTA
TNSESSTPSSGASTATNSDSSTTSSGASTATNSDSSTTSSEASTATNSESSTTSSGASTA
TNSESSTVSSRASTATNSESSTTSSGASTATNSESRTTSNGAGTATNSESSTTSSGASTA
TNSESSTPSSGAGTATNSESSTTSSGAGTATNSESSTVSSGISTVTNSESSTPSSGANTA
TNSESSTTSSGANTATNSDSSTTSSGASTATNSESSTTSSGASTATNSESSTTSSGASTA
TNSGSSTTSSGTSTATNSESSTVSSGASTATTSESSTTSSGASTATNSESSTVSSGASTA
TNSESSTTSSGANTATNSGSSVTSAGSGTAALTGMHTT
SHSASTAVSEAKPGGSLVPWEI
FLITLVSVVAAVGLFAGLFFCVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRP
RWSPNWFWRRPVSSIAMEMSGRNS
GP
Sequence length 566
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
Defective GALNT12 causes colorectal cancer 1 (CRCS1)
Dectin-2 family
O-linked glycosylation of mucins
Termination of O-glycan biosynthesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset) N/A N/A GWAS
Cervical Cancer Cervical cancer N/A N/A GWAS
Dental caries Dental caries N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 30973916, 31301084, 33786615
Carcinoma Non Small Cell Lung Associate 37858248
COVID 19 Associate 34448730
Depressive Disorder Associate 30626913
Depressive Disorder Major Associate 30626913
Diabetes Mellitus Type 1 Inhibit 37062177
Lung Neoplasms Stimulate 37858248
Mental Disorders Associate 30626913
Neoplasms Associate 31301084, 37858248
Pneumonia Associate 28302172