Gene Gene information from NCBI Gene database.
Entrez ID 394263
Gene name Mucin 21, cell surface associated
Gene symbol MUC21
Synonyms (NCBI Gene)
C6orf205KMQK697MUC-21
Chromosome 6
Chromosome location 6p21.33
Summary This gene encodes a large membrane-bound glycoprotein which is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in in
miRNA miRNA information provided by mirtarbase database.
212
miRTarBase ID miRNA Experiments Reference
MIRT050861 hsa-miR-17-5p CLASH 23622248
MIRT725361 hsa-miR-25-3p HITS-CLIP 19536157
MIRT725360 hsa-miR-32-5p HITS-CLIP 19536157
MIRT725359 hsa-miR-363-3p HITS-CLIP 19536157
MIRT725358 hsa-miR-367-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
GO ID Ontology Definition Evidence Reference
GO:0005796 Component Golgi lumen TAS
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616991 21661 ENSG00000204544
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5SSG8
Protein name Mucin-21 (MUC-21) (Epiglycanin)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05647 Epiglycanin_TR 18 83 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 76 137 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 123 182 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 167 227 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 181 239 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 211 274 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 271 334 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 331 393 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF05647 Epiglycanin_TR 391 458 Tandem-repeating region of mucin, epiglycanin-like Repeat
PF14654 Epiglycanin_C 463 564 Mucin, catalytic, TM and cytoplasmic tail region Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in lung, large intestine, thymus, and testis. Expressed in normal and malignant bronchial epithelial cells. {ECO:0000269|PubMed:17977904}.
Sequence
MKMQKGNVLLMFGLLLHLEAATNSNETSTSANTGSSVISSGASTATNSGSSVTSSGVSTA
TISGSSVTSNGVSIV
TNSEFHTTSSGISTATNSEFSTVSSGISIATNSESSTTSSGASTA
TNSESSTPSSGASTATNSDSSTTSSGASTATNSDSSTTSSEASTATNSESSTTSSGASTA
TNSESSTVSSRASTATNSESSTTSSGASTATNSESRTTSNGAGTATNSESSTTSSGASTA
TNSESSTPSSGAGTATNSESSTTSSGAGTATNSESSTVSSGISTVTNSESSTPSSGANTA
TNSESSTTSSGANTATNSDSSTTSSGASTATNSESSTTSSGASTATNSESSTTSSGASTA
TNSGSSTTSSGTSTATNSESSTVSSGASTATTSESSTTSSGASTATNSESSTVSSGASTA
TNSESSTTSSGANTATNSGSSVTSAGSGTAALTGMHTT
SHSASTAVSEAKPGGSLVPWEI
FLITLVSVVAAVGLFAGLFFCVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRP
RWSPNWFWRRPVSSIAMEMSGRNS
GP
Sequence length 566
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
Defective GALNT12 causes colorectal cancer 1 (CRCS1)
Dectin-2 family
O-linked glycosylation of mucins
Termination of O-glycan biosynthesis
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs199585334 RCV004557818
MUC21-related disorder Likely benign rs879175565 RCV003969137
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 30973916, 31301084, 33786615
Carcinoma Non Small Cell Lung Associate 37858248
COVID 19 Associate 34448730
Depressive Disorder Associate 30626913
Depressive Disorder Major Associate 30626913
Diabetes Mellitus Type 1 Inhibit 37062177
Lung Neoplasms Stimulate 37858248
Mental Disorders Associate 30626913
Neoplasms Associate 31301084, 37858248
Pneumonia Associate 28302172