Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3934
Gene name Gene Name - the full gene name approved by the HGNC.	Lipocalin 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LCN2
Synonyms (NCBI Gene) Gene synonyms aliases	24p3, MSFI, NGAL, p25
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q34.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that belongs to the lipocalin family. Members of this family transport small hydrophobic molecules such as lipids, steroid hormones and retinoids. The protein encoded by this gene is a neutrophil gelatinase-associated lipocalin

Show/Hide all(8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438755	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	23300839
MIRT438755	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	23300839
MIRT438755	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	23300839
MIRT438755	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	23300839
MIRT2029206	hsa-miR-1293	CLIP-seq
MIRT2029207	hsa-miR-4483	CLIP-seq
MIRT2029208	hsa-miR-646	CLIP-seq
MIRT2029209	hsa-miR-939	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
NFKB1	Activation	15536164
NFKB1	Unknown	19707556;20220144;24391115
NR3C2	Unknown	22469622
RELA	Activation	15536164
RELA	Unknown	19707556;20220144;24391115
STAT1	Unknown	24391115

Show/Hide all(74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005506	Function	Iron ion binding	IDA	27780864
GO:0005506	Function	Iron ion binding	IEA
GO:0005506	Function	Iron ion binding	ISS
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	ISS
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	25645918, 27780864
GO:0005615	Component	Extracellular space	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006826	Process	Iron ion transport	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006953	Process	Acute-phase response	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007614	Process	Short-term memory	IEA
GO:0007616	Process	Long-term memory	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009615	Process	Response to virus	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009635	Process	Response to herbicide	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0009637	Process	Response to blue light	IEA
GO:0009750	Process	Response to fructose	IEA
GO:0010040	Process	Response to iron(II) ion	IEA
GO:0010046	Process	Response to mycotoxin	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0015891	Process	Siderophore transport	IEA
GO:0015891	Process	Siderophore transport	ISS
GO:0031346	Process	Positive regulation of cell projection organization	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031669	Process	Cellular response to nutrient levels	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0036094	Function	Small molecule binding	IEA
GO:0036295	Process	Cellular response to increased oxygen levels	IEA
GO:0042742	Process	Defense response to bacterium	IDA	27780864
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS
GO:0060205	Component	Cytoplasmic vesicle lumen	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0071354	Process	Cellular response to interleukin-6	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071481	Process	Cellular response to X-ray	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0110090	Process	Positive regulation of hippocampal neuron apoptotic process	IEA
GO:0110091	Process	Negative regulation of hippocampal neuron apoptotic process	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	20332347
GO:0140315	Function	Iron ion sequestering activity	IDA	27780864
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IEA
GO:1903981	Function	Enterobactin binding	IDA	27780864, 35101443
GO:1903981	Function	Enterobactin binding	IEA
GO:1904373	Process	Response to kainic acid	IEA
GO:1904440	Process	Positive regulation of iron ion import across plasma membrane	IEA
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1905956	Process	Positive regulation of endothelial tube morphogenesis	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
600181	6526	ENSG00000148346

Protein

UniProt ID

P80188

Protein name

Neutrophil gelatinase-associated lipocalin (NGAL) (25 kDa alpha-2-microglobulin-related subunit of MMP-9) (Lipocalin-2) (Oncogene 24p3) (Siderocalin) (p25)

Protein function

Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development (PubMed:12453413, PubMed:20581821, PubMed:27780864). Binds iron through association with 2,3-dihydroxybenzoic acid (2,3-DHBA), a sid

PDB

1DFV , 1L6M , 1NGL , 1QQS , 1X71 , 1X89 , 1X8U , 3BY0 , 3CBC , 3CMP , 3DSZ , 3DTQ , 3FW4 , 3FW5 , 3HWD , 3HWE , 3HWF , 3HWG , 3I0A , 3K3L , 3PEC , 3PED , 3T1D , 3TF6 , 3TZS , 3U0D , 4GH7 , 4IAW , 4IAX , 4K19 , 4MVI , 4MVK , 4MVL , 4QAE , 4ZFX , 4ZHC , 4ZHD , 4ZHF , 4ZHG , 4ZHH , 5JR8 , 5KHP , 5KIC , 5KID , 5MHH , 5N47 , 5N48 , 5NKN , 6GQZ , 6GR0 , 6O5D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	48 → 193	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in neutrophils (at protein level) (PubMed:7683678, PubMed:8298140). Expressed in bone marrow and in tissues that are prone to exposure to microorganism (PubMed:9339356). High expression is found in bone marrow as well as in ut

Sequence

MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNA
ILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSY
PGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLG
LPENHIVFPVPIDQCIDG

Sequence length

198

Interactions

View interactions

	KEGG		Reactome
	IL-17 signaling pathway		Interleukin-4 and Interleukin-13 signaling Neutrophil degranulation Metal sequestration by antimicrobial proteins Iron uptake and transport

LCN2 (lipocalin 2)