LAMP1 (lysosomal associated membrane protein 1)

Gene

• Entrez ID: 3916
• Gene name: Lysosomal associated membrane protein 1
• Gene symbol: LAMP1
• Synonyms (NCBI Gene): CD107a, LAMPA, LGP120
• Chromosome: 13
• Chromosome location: 13q34
• Summary: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019659	hsa-miR-378a-3p	Sequencing	20371350
MIRT023236	hsa-miR-122-5p	Microarray	17612493
MIRT019659	hsa-miR-378a-3p	CLASH	23622248
MIRT041727	hsa-miR-484	CLASH	23622248
MIRT039887	hsa-miR-615-3p	CLASH	23622248
MIRT036408	hsa-miR-1227-3p	CLASH	23622248
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	25030422
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	25030422
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	25030422
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	25030422
MIRT1103475	hsa-miR-1255a	CLIP-seq
MIRT1103476	hsa-miR-1255b	CLIP-seq
MIRT1103477	hsa-miR-1267	CLIP-seq
MIRT1103478	hsa-miR-153	CLIP-seq
MIRT1103479	hsa-miR-2276	CLIP-seq
MIRT1103480	hsa-miR-23a	CLIP-seq
MIRT1103481	hsa-miR-23b	CLIP-seq
MIRT1103482	hsa-miR-23c	CLIP-seq
MIRT1103483	hsa-miR-3160-3p	CLIP-seq
MIRT1103484	hsa-miR-3176	CLIP-seq
MIRT1103485	hsa-miR-3177-5p	CLIP-seq
MIRT1103486	hsa-miR-320a	CLIP-seq
MIRT1103487	hsa-miR-320b	CLIP-seq
MIRT1103488	hsa-miR-320c	CLIP-seq
MIRT1103489	hsa-miR-320d	CLIP-seq
MIRT1103490	hsa-miR-3545-3p	CLIP-seq
MIRT1103491	hsa-miR-3664-5p	CLIP-seq
MIRT1103492	hsa-miR-3919	CLIP-seq
MIRT1103493	hsa-miR-3922-3p	CLIP-seq
MIRT1103494	hsa-miR-4281	CLIP-seq
MIRT1103495	hsa-miR-4429	CLIP-seq
MIRT1103496	hsa-miR-4433	CLIP-seq
MIRT1103497	hsa-miR-4459	CLIP-seq
MIRT1103498	hsa-miR-4487	CLIP-seq
MIRT1103499	hsa-miR-4539	CLIP-seq
MIRT1103500	hsa-miR-4640-3p	CLIP-seq
MIRT1103501	hsa-miR-4696	CLIP-seq
MIRT1103502	hsa-miR-4714-5p	CLIP-seq
MIRT1103503	hsa-miR-4756-3p	CLIP-seq
MIRT1103504	hsa-miR-4768-3p	CLIP-seq
MIRT1103505	hsa-miR-548al	CLIP-seq
MIRT1103506	hsa-miR-558	CLIP-seq
MIRT1103475	hsa-miR-1255a	CLIP-seq
MIRT1103476	hsa-miR-1255b	CLIP-seq
MIRT2028269	hsa-miR-1265	CLIP-seq
MIRT1103477	hsa-miR-1267	CLIP-seq
MIRT1103478	hsa-miR-153	CLIP-seq
MIRT2028270	hsa-miR-2054	CLIP-seq
MIRT1103479	hsa-miR-2276	CLIP-seq
MIRT2028271	hsa-miR-2392	CLIP-seq
MIRT1103480	hsa-miR-23a	CLIP-seq
MIRT1103481	hsa-miR-23b	CLIP-seq
MIRT1103482	hsa-miR-23c	CLIP-seq
MIRT2028272	hsa-miR-3183	CLIP-seq
MIRT2028273	hsa-miR-3591-3p	CLIP-seq
MIRT2028274	hsa-miR-3613-5p	CLIP-seq
MIRT2028275	hsa-miR-4326	CLIP-seq
MIRT2028276	hsa-miR-452	CLIP-seq
MIRT2028277	hsa-miR-4653-3p	CLIP-seq
MIRT2028278	hsa-miR-4672	CLIP-seq
MIRT2028279	hsa-miR-4676-3p	CLIP-seq
MIRT2028280	hsa-miR-4684-5p	CLIP-seq
MIRT1103501	hsa-miR-4696	CLIP-seq
MIRT2028281	hsa-miR-4723-3p	CLIP-seq
MIRT2028282	hsa-miR-4773	CLIP-seq
MIRT2028283	hsa-miR-548c-3p	CLIP-seq
MIRT2028284	hsa-miR-550a	CLIP-seq
MIRT2028285	hsa-miR-580	CLIP-seq
MIRT2028286	hsa-miR-642a	CLIP-seq
MIRT2028287	hsa-miR-651	CLIP-seq
MIRT2259421	hsa-miR-106a	CLIP-seq
MIRT2259422	hsa-miR-106b	CLIP-seq
MIRT2259423	hsa-miR-1202	CLIP-seq
MIRT1103475	hsa-miR-1255a	CLIP-seq
MIRT1103476	hsa-miR-1255b	CLIP-seq
MIRT1103477	hsa-miR-1267	CLIP-seq
MIRT2259424	hsa-miR-129-3p	CLIP-seq
MIRT2259425	hsa-miR-1303	CLIP-seq
MIRT1103478	hsa-miR-153	CLIP-seq
MIRT2259426	hsa-miR-17	CLIP-seq
MIRT2259427	hsa-miR-20a	CLIP-seq
MIRT2259428	hsa-miR-20b	CLIP-seq
MIRT1103479	hsa-miR-2276	CLIP-seq
MIRT1103480	hsa-miR-23a	CLIP-seq
MIRT1103481	hsa-miR-23b	CLIP-seq
MIRT1103482	hsa-miR-23c	CLIP-seq
MIRT2259429	hsa-miR-3130-5p	CLIP-seq
MIRT2259430	hsa-miR-3158-5p	CLIP-seq
MIRT1103483	hsa-miR-3160-3p	CLIP-seq
MIRT2259431	hsa-miR-3166	CLIP-seq
MIRT2259432	hsa-miR-3194-5p	CLIP-seq
MIRT1103486	hsa-miR-320a	CLIP-seq
MIRT1103487	hsa-miR-320b	CLIP-seq
MIRT1103488	hsa-miR-320c	CLIP-seq
MIRT1103489	hsa-miR-320d	CLIP-seq
MIRT2259433	hsa-miR-342-3p	CLIP-seq
MIRT1103490	hsa-miR-3545-3p	CLIP-seq
MIRT2028273	hsa-miR-3591-3p	CLIP-seq
MIRT1103491	hsa-miR-3664-5p	CLIP-seq
MIRT2259434	hsa-miR-3972	CLIP-seq
MIRT2259435	hsa-miR-421	CLIP-seq
MIRT1103495	hsa-miR-4429	CLIP-seq
MIRT2259436	hsa-miR-4482	CLIP-seq
MIRT1103498	hsa-miR-4487	CLIP-seq
MIRT1103499	hsa-miR-4539	CLIP-seq
MIRT2028278	hsa-miR-4672	CLIP-seq
MIRT2259437	hsa-miR-4695-3p	CLIP-seq
MIRT1103501	hsa-miR-4696	CLIP-seq
MIRT2259438	hsa-miR-4709-5p	CLIP-seq
MIRT1103502	hsa-miR-4714-5p	CLIP-seq
MIRT2259439	hsa-miR-4766-3p	CLIP-seq
MIRT2259440	hsa-miR-4771	CLIP-seq
MIRT2028282	hsa-miR-4773	CLIP-seq
MIRT2259441	hsa-miR-4780	CLIP-seq
MIRT2259442	hsa-miR-4802-5p	CLIP-seq
MIRT2259443	hsa-miR-505	CLIP-seq
MIRT2259444	hsa-miR-518e	CLIP-seq
MIRT2259445	hsa-miR-519d	CLIP-seq
MIRT1103505	hsa-miR-548al	CLIP-seq
MIRT2028283	hsa-miR-548c-3p	CLIP-seq
MIRT2259446	hsa-miR-548p	CLIP-seq
MIRT2259447	hsa-miR-548t	CLIP-seq
MIRT1103506	hsa-miR-558	CLIP-seq
MIRT2259448	hsa-miR-93	CLIP-seq
MIRT2438312	hsa-miR-1247	CLIP-seq
MIRT2438313	hsa-miR-1538	CLIP-seq
MIRT1103484	hsa-miR-3176	CLIP-seq
MIRT2259432	hsa-miR-3194-5p	CLIP-seq
MIRT1103486	hsa-miR-320a	CLIP-seq
MIRT1103487	hsa-miR-320b	CLIP-seq
MIRT1103488	hsa-miR-320c	CLIP-seq
MIRT1103489	hsa-miR-320d	CLIP-seq
MIRT1103490	hsa-miR-3545-3p	CLIP-seq
MIRT1103493	hsa-miR-3922-3p	CLIP-seq
MIRT1103495	hsa-miR-4429	CLIP-seq
MIRT1103499	hsa-miR-4539	CLIP-seq
MIRT2438314	hsa-miR-4691-3p	CLIP-seq
MIRT2438315	hsa-miR-4745-3p	CLIP-seq
MIRT2438316	hsa-miR-644	CLIP-seq
MIRT2438317	hsa-miR-663b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000421	Component	Autophagosome membrane	IEA
GO:0001618	Function	Virus receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	21194361, 23394946, 24970085, 32296183, 37390818
GO:0005737	Component	Cytoplasm	IDA	21266579
GO:0005764	Component	Lysosome	IDA	15613468
GO:0005764	Component	Lysosome	IDA	15052268, 15292400, 16542649, 22792322, 23704327
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	TAS	3131762
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IDA	16176980
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	ISS
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IDA	15052268, 15292400, 15792797, 16542649, 18388320, 18767904
GO:0005770	Component	Late endosome	IEA
GO:0005771	Component	Multivesicular body	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20956541
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	3174652
GO:0007042	Process	Lysosomal lumen acidification	IDA	37390818
GO:0007042	Process	Lysosomal lumen acidification	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008200	Function	Ion channel inhibitor activity	IDA	37390818
GO:0008200	Function	Ion channel inhibitor activity	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0010008	Component	Endosome membrane	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	3174652
GO:0019899	Function	Enzyme binding	IPI	22641697
GO:0019904	Function	Protein domain specific binding	IEA
GO:0031902	Component	Late endosome membrane	IBA
GO:0031902	Component	Late endosome membrane	IEA
GO:0031982	Component	Vesicle	IEA
GO:0035577	Component	Azurophil granule membrane	IEA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0035752	Process	Lysosomal lumen pH elevation	IDA	35750034
GO:0042383	Component	Sarcolemma	IEA
GO:0042470	Component	Melanosome	IEA
GO:0043323	Process	Positive regulation of natural killer cell degranulation	IMP	23632890
GO:0044194	Component	Cytolytic granule	IEA
GO:0044754	Component	Autolysosome	IEA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IMP	23632890
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IMP	18787122
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0061474	Component	Phagolysosome membrane	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072594	Process	Establishment of protein localization to organelle	IBA
GO:0072594	Process	Establishment of protein localization to organelle	IMP	23632890
GO:0090160	Process	Golgi to lysosome transport	IMP	23632890
GO:0101003	Component	Ficolin-1-rich granule membrane	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:0101004	Component	Cytolytic granule membrane	IDA	24088571
GO:0101004	Component	Cytolytic granule membrane	IEA
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IMP	23632890
GO:1902513	Process	Regulation of organelle transport along microtubule	IMP	23632890
GO:1902600	Process	Proton transmembrane transport	IDA	35750034

Other IDs

• MIM: 153330
• HGNC: 6499
• e!Ensembl: ENSG00000185896

Protein

• UniProt ID: P11279
• Protein name: Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)
• Protein function: Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, lysosomal pH regulation, autophagy and cholesterol homeostasis (PubMed:37390818). Acts as an important regulator of lysosomal lumen pH regulation by acting as
• PDB: 8ATH, 8FY5, 8FYF, 9C59, 9C5A, 9C5B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01299	Lamp	217 → 365	Lysosome-associated membrane glycoprotein (Lamp)	Family

• Sequence:

  MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGP
  KNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVY
  NLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLS
  NSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQL
  NLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF
  LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQ
  AFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI

• Sequence length: 417

Pathways

KEGG:

Virion - Hepatitis viruses
Virion - Lassa virus and SFTS virus
Autophagy - animal
Lysosome
Phagosome
Tuberculosis

Reactome:

Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	32873769	★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	31784980	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	26627638, 28984607, 37418137	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Stimulate	26936765	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ascites	Inhibit	21203522	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	25633562	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Associate	23826410	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Associate	28170096, 30319620	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	19522481, 27560716, 34543006, 7511141	★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	1544942	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Associate	11815981	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	38218945	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	25063738	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	23172893	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	29444517	★☆☆☆☆ Found in Text Mining only
Carney Complex	Associate	37122702	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Inhibit	23286717	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Associate	36059513	★☆☆☆☆ Found in Text Mining only
Chromosome Aberrations	Associate	18683215	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	11485903	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Stimulate	30988067	★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Stimulate	26936765	★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Associate	27061067	★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	35908408	★☆☆☆☆ Found in Text Mining only
Cytomegalovirus Infections	Associate	17158960, 31019052, 31522446	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	38302650	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	29236750	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	29236750	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	25633562, 29518421	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Inhibit	33123602	★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Associate	33218198	★☆☆☆☆ Found in Text Mining only
Epileptic Encephalopathy Early Infantile 3	Inhibit	35675510	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Associate	28275109	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Inhibit	39394558	★☆☆☆☆ Found in Text Mining only
Fibromyalgia	Associate	34913882	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Associate	29790198	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	26863628	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	31649684	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Associate	32051464	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Stimulate	32849519	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Stimulate	32358389	★☆☆☆☆ Found in Text Mining only
HIV Infections	Stimulate	24351015, 31190065	★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	30625227, 32554696, 34853078	★☆☆☆☆ Found in Text Mining only
HIV Infections	Inhibit	30817998	★☆☆☆☆ Found in Text Mining only
Hutchinson's Melanotic Freckle	Stimulate	8151127	★☆☆☆☆ Found in Text Mining only
Hypoxia	Inhibit	32255193, 33123602	★☆☆☆☆ Found in Text Mining only
Infections	Associate	32285133	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	30625227	★☆☆☆☆ Found in Text Mining only
Influenza Human	Stimulate	26517304	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	34482820	★☆☆☆☆ Found in Text Mining only
Lead Poisoning Nervous System	Associate	34680130	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	27907031, 36960055	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	35121522	★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic T Cell	Stimulate	21463298	★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic T Cell	Associate	29286619	★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Stimulate	32161179	★☆☆☆☆ Found in Text Mining only
Leukodystrophy Globoid Cell	Associate	36113749	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Associate	26627638	★☆☆☆☆ Found in Text Mining only
Lichen Planus	Associate	26632637	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	22028659, 31049024	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Associate	16778144, 24916509, 27413758, 28270454, 32375849	★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Cutaneous	Associate	34774537	★☆☆☆☆ Found in Text Mining only
Lysosomal Storage Diseases	Inhibit	35675510	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Inhibit	25251993	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	30728070, 36087066	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	29089645	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	23656307	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Associate	39346912	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Associate	22310933	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	11485903, 11815981, 18594005, 19237639, 19638292, 20331905, 21829468, 21955245, 23826410, 25435072, 26449523, 27212625, 27447745, 29487385, 31377388, 33133307, 35813574, 37711623, 37894816	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	29791021	★☆☆☆☆ Found in Text Mining only
Netherton Syndrome	Associate	30477583	★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Associate	25719800	★☆☆☆☆ Found in Text Mining only
Neuronal Ceroid Lipofuscinoses	Associate	35506243	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	23172893	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	11815981, 27109098	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Associate	31101076	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	27061067, 30055128	★☆☆☆☆ Found in Text Mining only
Pleural Effusion	Associate	19664147	★☆☆☆☆ Found in Text Mining only
Poikiloderma with Neutropenia	Stimulate	31067781	★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	19388935	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	27212625	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms Castration Resistant	Stimulate	27212625	★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	31067781	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	33174446	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Associate	23799359	★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Associate	35908408	★☆☆☆☆ Found in Text Mining only
Severe Dengue	Associate	31568656	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Associate	29980238	★☆☆☆☆ Found in Text Mining only
Spinal Cord Injuries	Associate	27618987	★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Associate	27061067	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	38436206	★☆☆☆☆ Found in Text Mining only
Tuberculosis	Stimulate	31190065	★☆☆☆☆ Found in Text Mining only
Tuberculosis Meningeal	Inhibit	33828558	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	31215164	★☆☆☆☆ Found in Text Mining only
Vacuolar myopathy	Associate	35740979	★☆☆☆☆ Found in Text Mining only
Zika Virus Infection	Stimulate	33525328	★☆☆☆☆ Found in Text Mining only