Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3916
Gene name Gene Name - the full gene name approved by the HGNC.	Lysosomal associated membrane protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LAMP1
Synonyms (NCBI Gene) Gene synonyms aliases	CD107a, LAMPA, LGP120
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q34
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis. [provided by RefSeq, Jul 2008]

Show/Hide all(140)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019659	hsa-miR-378a-3p	Sequencing	20371350
MIRT023236	hsa-miR-122-5p	Microarray	17612493
MIRT019659	hsa-miR-378a-3p	CLASH	23622248
MIRT041727	hsa-miR-484	CLASH	23622248
MIRT039887	hsa-miR-615-3p	CLASH	23622248
MIRT036408	hsa-miR-1227-3p	CLASH	23622248
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	25030422
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	25030422
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	25030422
MIRT438535	hsa-miR-23a-3p	Luciferase reporter assay, qRT-PCR	25030422
MIRT1103475	hsa-miR-1255a	CLIP-seq
MIRT1103476	hsa-miR-1255b	CLIP-seq
MIRT1103477	hsa-miR-1267	CLIP-seq
MIRT1103478	hsa-miR-153	CLIP-seq
MIRT1103479	hsa-miR-2276	CLIP-seq
MIRT1103480	hsa-miR-23a	CLIP-seq
MIRT1103481	hsa-miR-23b	CLIP-seq
MIRT1103482	hsa-miR-23c	CLIP-seq
MIRT1103483	hsa-miR-3160-3p	CLIP-seq
MIRT1103484	hsa-miR-3176	CLIP-seq
MIRT1103485	hsa-miR-3177-5p	CLIP-seq
MIRT1103486	hsa-miR-320a	CLIP-seq
MIRT1103487	hsa-miR-320b	CLIP-seq
MIRT1103488	hsa-miR-320c	CLIP-seq
MIRT1103489	hsa-miR-320d	CLIP-seq
MIRT1103490	hsa-miR-3545-3p	CLIP-seq
MIRT1103491	hsa-miR-3664-5p	CLIP-seq
MIRT1103492	hsa-miR-3919	CLIP-seq
MIRT1103493	hsa-miR-3922-3p	CLIP-seq
MIRT1103494	hsa-miR-4281	CLIP-seq
MIRT1103495	hsa-miR-4429	CLIP-seq
MIRT1103496	hsa-miR-4433	CLIP-seq
MIRT1103497	hsa-miR-4459	CLIP-seq
MIRT1103498	hsa-miR-4487	CLIP-seq
MIRT1103499	hsa-miR-4539	CLIP-seq
MIRT1103500	hsa-miR-4640-3p	CLIP-seq
MIRT1103501	hsa-miR-4696	CLIP-seq
MIRT1103502	hsa-miR-4714-5p	CLIP-seq
MIRT1103503	hsa-miR-4756-3p	CLIP-seq
MIRT1103504	hsa-miR-4768-3p	CLIP-seq
MIRT1103505	hsa-miR-548al	CLIP-seq
MIRT1103506	hsa-miR-558	CLIP-seq
MIRT1103475	hsa-miR-1255a	CLIP-seq
MIRT1103476	hsa-miR-1255b	CLIP-seq
MIRT2028269	hsa-miR-1265	CLIP-seq
MIRT1103477	hsa-miR-1267	CLIP-seq
MIRT1103478	hsa-miR-153	CLIP-seq
MIRT2028270	hsa-miR-2054	CLIP-seq
MIRT1103479	hsa-miR-2276	CLIP-seq
MIRT2028271	hsa-miR-2392	CLIP-seq
MIRT1103480	hsa-miR-23a	CLIP-seq
MIRT1103481	hsa-miR-23b	CLIP-seq
MIRT1103482	hsa-miR-23c	CLIP-seq
MIRT2028272	hsa-miR-3183	CLIP-seq
MIRT2028273	hsa-miR-3591-3p	CLIP-seq
MIRT2028274	hsa-miR-3613-5p	CLIP-seq
MIRT2028275	hsa-miR-4326	CLIP-seq
MIRT2028276	hsa-miR-452	CLIP-seq
MIRT2028277	hsa-miR-4653-3p	CLIP-seq
MIRT2028278	hsa-miR-4672	CLIP-seq
MIRT2028279	hsa-miR-4676-3p	CLIP-seq
MIRT2028280	hsa-miR-4684-5p	CLIP-seq
MIRT1103501	hsa-miR-4696	CLIP-seq
MIRT2028281	hsa-miR-4723-3p	CLIP-seq
MIRT2028282	hsa-miR-4773	CLIP-seq
MIRT2028283	hsa-miR-548c-3p	CLIP-seq
MIRT2028284	hsa-miR-550a	CLIP-seq
MIRT2028285	hsa-miR-580	CLIP-seq
MIRT2028286	hsa-miR-642a	CLIP-seq
MIRT2028287	hsa-miR-651	CLIP-seq
MIRT2259421	hsa-miR-106a	CLIP-seq
MIRT2259422	hsa-miR-106b	CLIP-seq
MIRT2259423	hsa-miR-1202	CLIP-seq
MIRT1103475	hsa-miR-1255a	CLIP-seq
MIRT1103476	hsa-miR-1255b	CLIP-seq
MIRT1103477	hsa-miR-1267	CLIP-seq
MIRT2259424	hsa-miR-129-3p	CLIP-seq
MIRT2259425	hsa-miR-1303	CLIP-seq
MIRT1103478	hsa-miR-153	CLIP-seq
MIRT2259426	hsa-miR-17	CLIP-seq
MIRT2259427	hsa-miR-20a	CLIP-seq
MIRT2259428	hsa-miR-20b	CLIP-seq
MIRT1103479	hsa-miR-2276	CLIP-seq
MIRT1103480	hsa-miR-23a	CLIP-seq
MIRT1103481	hsa-miR-23b	CLIP-seq
MIRT1103482	hsa-miR-23c	CLIP-seq
MIRT2259429	hsa-miR-3130-5p	CLIP-seq
MIRT2259430	hsa-miR-3158-5p	CLIP-seq
MIRT1103483	hsa-miR-3160-3p	CLIP-seq
MIRT2259431	hsa-miR-3166	CLIP-seq
MIRT2259432	hsa-miR-3194-5p	CLIP-seq
MIRT1103486	hsa-miR-320a	CLIP-seq
MIRT1103487	hsa-miR-320b	CLIP-seq
MIRT1103488	hsa-miR-320c	CLIP-seq
MIRT1103489	hsa-miR-320d	CLIP-seq
MIRT2259433	hsa-miR-342-3p	CLIP-seq
MIRT1103490	hsa-miR-3545-3p	CLIP-seq
MIRT2028273	hsa-miR-3591-3p	CLIP-seq
MIRT1103491	hsa-miR-3664-5p	CLIP-seq
MIRT2259434	hsa-miR-3972	CLIP-seq
MIRT2259435	hsa-miR-421	CLIP-seq
MIRT1103495	hsa-miR-4429	CLIP-seq
MIRT2259436	hsa-miR-4482	CLIP-seq
MIRT1103498	hsa-miR-4487	CLIP-seq
MIRT1103499	hsa-miR-4539	CLIP-seq
MIRT2028278	hsa-miR-4672	CLIP-seq
MIRT2259437	hsa-miR-4695-3p	CLIP-seq
MIRT1103501	hsa-miR-4696	CLIP-seq
MIRT2259438	hsa-miR-4709-5p	CLIP-seq
MIRT1103502	hsa-miR-4714-5p	CLIP-seq
MIRT2259439	hsa-miR-4766-3p	CLIP-seq
MIRT2259440	hsa-miR-4771	CLIP-seq
MIRT2028282	hsa-miR-4773	CLIP-seq
MIRT2259441	hsa-miR-4780	CLIP-seq
MIRT2259442	hsa-miR-4802-5p	CLIP-seq
MIRT2259443	hsa-miR-505	CLIP-seq
MIRT2259444	hsa-miR-518e	CLIP-seq
MIRT2259445	hsa-miR-519d	CLIP-seq
MIRT1103505	hsa-miR-548al	CLIP-seq
MIRT2028283	hsa-miR-548c-3p	CLIP-seq
MIRT2259446	hsa-miR-548p	CLIP-seq
MIRT2259447	hsa-miR-548t	CLIP-seq
MIRT1103506	hsa-miR-558	CLIP-seq
MIRT2259448	hsa-miR-93	CLIP-seq
MIRT2438312	hsa-miR-1247	CLIP-seq
MIRT2438313	hsa-miR-1538	CLIP-seq
MIRT1103484	hsa-miR-3176	CLIP-seq
MIRT2259432	hsa-miR-3194-5p	CLIP-seq
MIRT1103486	hsa-miR-320a	CLIP-seq
MIRT1103487	hsa-miR-320b	CLIP-seq
MIRT1103488	hsa-miR-320c	CLIP-seq
MIRT1103489	hsa-miR-320d	CLIP-seq
MIRT1103490	hsa-miR-3545-3p	CLIP-seq
MIRT1103493	hsa-miR-3922-3p	CLIP-seq
MIRT1103495	hsa-miR-4429	CLIP-seq
MIRT1103499	hsa-miR-4539	CLIP-seq
MIRT2438314	hsa-miR-4691-3p	CLIP-seq
MIRT2438315	hsa-miR-4745-3p	CLIP-seq
MIRT2438316	hsa-miR-644	CLIP-seq
MIRT2438317	hsa-miR-663b	CLIP-seq

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000421	Component	Autophagosome membrane	IEA
GO:0001618	Function	Virus receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	23394946, 24970085, 32296183
GO:0005737	Component	Cytoplasm	IDA	21266579
GO:0005764	Component	Lysosome	IDA	15052268, 15292400, 15613468, 16542649, 22792322, 23704327
GO:0005764	Component	Lysosome	IDA	15613468
GO:0005765	Component	Lysosomal membrane	IBA	21873635
GO:0005765	Component	Lysosomal membrane	ISS
GO:0005770	Component	Late endosome	IDA	15052268, 15292400, 15792797, 16542649, 18388320, 18767904
GO:0005771	Component	Multivesicular body	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	20956541
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	3174652
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010008	Component	Endosome membrane	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0019899	Function	Enzyme binding	IPI	22641697
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030285	Component	Integral component of synaptic vesicle membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031902	Component	Late endosome membrane	IBA	21873635
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0042383	Component	Sarcolemma	IEA
GO:0042470	Component	Melanosome	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043323	Process	Positive regulation of natural killer cell degranulation	IMP	23632890
GO:0044194	Component	Cytolytic granule	IEA
GO:0044754	Component	Autolysosome	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IMP	23632890
GO:0046718	Process	Viral entry into host cell	IEA
GO:0048102	Process	Autophagic cell death	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IMP	18787122
GO:0050821	Process	Protein stabilization	ISS
GO:0061474	Component	Phagolysosome membrane	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072594	Process	Establishment of protein localization to organelle	IBA	21873635
GO:0072594	Process	Establishment of protein localization to organelle	IMP	23632890
GO:0090160	Process	Golgi to lysosome transport	IMP	23632890
GO:0097208	Component	Alveolar lamellar body	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IMP	23632890
GO:1902513	Process	Regulation of organelle transport along microtubule	IMP	23632890

MIM	HGNC	e!Ensembl
153330	6499	ENSG00000185896

Protein

UniProt ID

P11279

Protein name

Lysosome-associated membrane glycoprotein 1 (LAMP-1) (Lysosome-associated membrane protein 1) (CD107 antigen-like family member A) (CD antigen CD107a)

Protein function

Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, lysosomal pH regulation, autophagy and cholesterol homeostasis (PubMed:37390818). Acts as an important regulator of lysosomal lumen pH regulation by acting as

PDB

8ATH , 8FY5 , 8FYF , 9C59 , 9C5A , 9C5B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01299	Lamp	217 → 365	Lysosome-associated membrane glycoprotein (Lamp)	Family

Sequence

MAAPGSARRPLLLLLLLLLLGLMHCASAAMFMVKNGNGTACIMANFSAAFSVNYDTKSGP
KNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVY
NLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLS
NSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQL
NLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFF
LQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQ
AFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIVLIAYLVGRKRSHAGYQTI

Sequence length

417

Interactions

View interactions

	KEGG		Reactome
	Virion - Hepatitis viruses Virion - Lassa virus and SFTS virus Autophagy - animal Lysosome Phagosome Tuberculosis		Neutrophil degranulation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	26830138

Show/Hide Text Mining Associations (97)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	32873769
Adenoma	Associate	31784980
Alzheimer Disease	Associate	26627638, 28984607, 37418137
Alzheimer Disease	Stimulate	26936765
Ascites	Inhibit	21203522
Asthma	Associate	25633562
Astrocytoma	Associate	23826410
Behcet Syndrome	Associate	28170096, 30319620
Breast Neoplasms	Associate	19522481, 27560716, 34543006, 7511141
Calcinosis Cutis	Associate	1544942
Carcinoma Ductal	Associate	11815981
Carcinoma Hepatocellular	Associate	38218945
Carcinoma Non Small Cell Lung	Associate	25063738
Carcinoma Ovarian Epithelial	Associate	23172893
Carcinoma Renal Cell	Associate	29444517
Carney Complex	Associate	37122702
Cerebral Infarction	Inhibit	23286717
Cholangitis Sclerosing	Associate	36059513
Chromosome Aberrations	Associate	18683215
Colorectal Neoplasms	Associate	11485903
Colorectal Neoplasms	Stimulate	30988067
Corticobasal Degeneration	Stimulate	26936765
Corticobasal Degeneration	Associate	27061067
COVID 19	Associate	35908408
Cytomegalovirus Infections	Associate	17158960, 31019052, 31522446
Dermatitis Atopic	Associate	38302650
Diabetes Mellitus	Associate	29236750
Diabetes Mellitus Type 1	Associate	29236750
Drug Hypersensitivity	Associate	25633562, 29518421
Drug Related Side Effects and Adverse Reactions	Inhibit	33123602
Epidermodysplasia Verruciformis	Associate	33218198
Epileptic Encephalopathy Early Infantile 3	Inhibit	35675510
Fatigue Syndrome Chronic	Associate	28275109
Fatigue Syndrome Chronic	Inhibit	39394558
Fibromyalgia	Associate	34913882
Frontotemporal Lobar Degeneration	Associate	29790198
Glioblastoma	Associate	26863628
Glioma	Associate	31649684
Glycogen Storage Disease Type II	Associate	32051464
Graft vs Host Disease	Stimulate	32849519
Hepatitis B	Stimulate	32358389
HIV Infections	Stimulate	24351015, 31190065
HIV Infections	Associate	30625227, 32554696, 34853078
HIV Infections	Inhibit	30817998
Hutchinson's Melanotic Freckle	Stimulate	8151127
Hypoxia	Inhibit	32255193, 33123602
Infections	Associate	32285133
Inflammation	Associate	30625227
Influenza Human	Stimulate	26517304
Kidney Neoplasms	Associate	34482820
Lead Poisoning Nervous System	Associate	34680130
Leukemia	Associate	27907031, 36960055
Leukemia Myeloid Acute	Associate	35121522
Leukemia Prolymphocytic T Cell	Stimulate	21463298
Leukemia Prolymphocytic T Cell	Associate	29286619
Leukocyte adhesion deficiency type 1	Stimulate	32161179
Leukodystrophy Globoid Cell	Associate	36113749
Lewy Body Disease	Associate	26627638
Lichen Planus	Associate	26632637
Lupus Erythematosus Systemic	Associate	22028659, 31049024
Lymphohistiocytosis Hemophagocytic	Associate	16778144, 24916509, 27413758, 28270454, 32375849
Lymphoma T Cell Cutaneous	Associate	34774537
Lysosomal Storage Diseases	Inhibit	35675510
Macular Degeneration	Inhibit	25251993
Melanoma	Associate	30728070, 36087066
Multiple Myeloma	Associate	29089645
Multiple Sclerosis	Associate	23656307
Myasthenia Gravis	Associate	39346912
Nasal Polyps	Associate	22310933
Neoplasms	Associate	11485903, 11815981, 18594005, 19237639, 19638292, 20331905, 21829468, 21955245, 23826410, 25435072, 26449523, 27212625, 27447745, 29487385, 31377388 View all (4 more)
Neoplasms	Inhibit	29791021
Netherton Syndrome	Associate	30477583
Neurocognitive Disorders	Associate	25719800
Neuronal Ceroid Lipofuscinoses	Associate	35506243
Ovarian Neoplasms	Associate	23172893
Pancreatic Neoplasms	Associate	11815981, 27109098
Paraparesis Tropical Spastic	Associate	31101076
Parkinson Disease	Associate	27061067, 30055128
Pleural Effusion	Associate	19664147
Poikiloderma with Neutropenia	Stimulate	31067781
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	19388935
Prostatic Neoplasms	Associate	27212625
Prostatic Neoplasms Castration Resistant	Stimulate	27212625
Psoriasis	Associate	31067781
Pulmonary Disease Chronic Obstructive	Associate	33174446
Rhabdomyosarcoma	Associate	23799359
Severe Acute Respiratory Syndrome	Associate	35908408
Severe Dengue	Associate	31568656
Spastic Paraplegia Hereditary	Associate	29980238
Spinal Cord Injuries	Associate	27618987
Supranuclear Palsy Progressive	Associate	27061067
Thyroid Neoplasms	Associate	38436206
Tuberculosis	Stimulate	31190065
Tuberculosis Meningeal	Inhibit	33828558
Uterine Cervical Neoplasms	Associate	31215164
Vacuolar myopathy	Associate	35740979
Zika Virus Infection	Stimulate	33525328

LAMP1 (lysosomal associated membrane protein 1)