SERPINA2 (serpin family A member 2 (gene/pseudogene))

Gene

• Entrez ID: 390502
• Gene name: Serpin family A member 2 (gene/pseudogene)
• Gene symbol: SERPINA2
• Synonyms (NCBI Gene): ARGS, ATR, PIL, SERPINA2P, psiATR
• Chromosome: 14
• Chromosome location: 14q32.13
• Summary: This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. The encoded intracellular glycoprotein is localized at the endoplasmic reticulum. This gene is a polymorphic pseudogene, with the non-functiona

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	TAS	2842251
GO:0005515	Function	Protein binding	IPI	23826168
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	23826168
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA

Other IDs

• MIM: 107410
• HGNC: 8985
• e!Ensembl: ENSG00000258597

Protein

• UniProt ID: P20848
• Protein name: Alpha-1-antitrypsin-related protein (AAT-related protein) (Protease inhibitor 1-like) (Serpin A2)
• Protein function: Putative serine protease inhibitor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00079	Serpin	55 → 417	Serpin (serine protease inhibitor)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the liver, leukocytes and testis. Also detected in brain, colon, uterus, esophagus, spleen, trachea, kidney and lung. {ECO:0000269|PubMed:17135331, ECO:0000269|PubMed:23826168}.
• Sequence:

  MPFSVSWGVLLLAGLCCLVPSSLVEDPQGDAAQKTDTSHHDQGDWEDLACQKISYNVTDL
  AFDLYKSWLIYHNQHVLVTPTSVAMAFRMLSLGTKADTRTEILEGLNVNLTETPEAKIHE
  CFQQVLQALSRPDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINFRDTEEAK
  EQINNYVEKRTGRKVVDLVKHLKKDTSLALVDYISFHGKWKDKFKAERIMVEGFHVDDKT
  IIRVPMINHLGRFDIHRDRELSSWVLAQHYVGNATAFFILPDPKKMWQLEEKLTYSHLEN
  IQRAFDIRSINLHFPKLSISGTYKLKRVPRNLGITKIFSNEADLSGVSQEAPLKLSKAVH
  VAVLTIDEKGTEATGAPHLEEKAWSKYQTVMFNRPFLVIIKEYITNFPLFIGKVVNPTQK
  

• Sequence length: 420